Align Probable Glycine/alanine/asparagine/glutamine uptake porter, AgcS (characterized)
to candidate WP_055436780.1 ASC41_RS11430 alanine:cation symporter family protein
Query= TCDB::W0WFC6 (449 letters) >NCBI__GCF_001418085.1:WP_055436780.1 Length = 458 Score = 351 bits (901), Expect = e-101 Identities = 194/455 (42%), Positives = 283/455 (62%), Gaps = 11/455 (2%) Query: 4 LQKWVVDLNGVVWGPLMLVLILGTGLYLMLGLKFMPLVRLGVGFRLLWQGRSKDDESSGE 63 + ++ D VWG +L+L++G G YL++ +F+P LG ++L +G+ + E SGE Sbjct: 5 INDFIADFASFVWGLPLLILLIGGGFYLLVLSRFLPFRYLGHAIQVL-RGKFDNPEDSGE 63 Query: 64 ISPFQALMTCLAATVGTGNIAGVATAIFLGGPGALFWMWCTALVGMATKFSEVVLAVHYR 123 I+ FQAL T L++T+G GNIAGVA AI +GGPGA+FWMW +A++GM+TKF LA+ YR Sbjct: 64 ITHFQALTTALSSTIGMGNIAGVAVAISIGGPGAVFWMWISAIIGMSTKFFTSSLAIMYR 123 Query: 124 EKDERNEHVGGPMYAIKNGLGKRWAWLGAAFA---LFGGLAGFGIGNMVQ-VNSMA---D 176 KD + GGPMY I GLGK W L F+ L G L F + + Q +N + + Sbjct: 124 GKDSEGKTQGGPMYFITEGLGKHWKPLAVFFSLCGLIGALPVFNVNQLTQAINDIVLKPN 183 Query: 177 ALEVSFGVPDWVTGVATMLVTGLVILGGIRRIGKVAEALVPFMCVGYIVASVIVLVVHAE 236 + V+F + + G+ +++T +VILGG+ RI KVA LVP M + Y V +I+LV +AE Sbjct: 184 GIVVNF-TSNLIIGIVLVVITSIVILGGLNRISKVASKLVPSMVLLYFVLIMIILVANAE 242 Query: 237 AIPGAFQLIFTHAFTPIAATG-GFAGAAVMAAIRFGVARGIFSNEAGLGTAGIAQAAGTT 295 +P F+LIFT AF G F G + I GV RG FSNEAG+GTA +A A T Sbjct: 243 VVPTYFKLIFTDAFAAENYKGDAFLGGLLGGLIVLGVRRGAFSNEAGIGTAPLAHGAAKT 302 Query: 296 HSAVRSGLIGMLGTFIDTLIICSLTGLAIITSGVW-TSGASGAALSSAAFEAAMPGVGHY 354 + +R GL+ MLG IDTLI+C+LT LAI+ +GVW T+ A+G +L++ AF AAMP G Y Sbjct: 303 NEPIREGLVAMLGPAIDTLIVCTLTALAILVTGVWQTTEANGVSLTANAFGAAMPVYGRY 362 Query: 355 ILSLALVVFAYTTILGWSYYGERCWEYLAGTRAILPFRIVWTLAIPFGAMTQLDFAWLVA 414 +L L +VVF+ +++ ++YYG +C +L G + + + L+I GA T L + Sbjct: 363 LLLLCIVVFSVSSLFSYAYYGGKCLSFLIGDKNKHYYNYFYILSIILGATTSLALMINLI 422 Query: 415 DTLNALMAIPNLIALLLLSPVVFRLTREYFAKARS 449 D + ALMAIP + A L+L+P V + + YF + ++ Sbjct: 423 DGIFALMAIPTMTATLILAPRVVKEAKAYFKRMKN 457 Lambda K H 0.326 0.140 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 449 Length of database: 458 Length adjustment: 33 Effective length of query: 416 Effective length of database: 425 Effective search space: 176800 Effective search space used: 176800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory