Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate WP_055434896.1 ASC41_RS01600 dihydroxy-acid dehydratase
Query= reanno::Smeli:SM_b20890 (579 letters) >NCBI__GCF_001418085.1:WP_055434896.1 Length = 559 Score = 313 bits (801), Expect = 2e-89 Identities = 194/531 (36%), Positives = 295/531 (55%), Gaps = 19/531 (3%) Query: 44 RPIIGICNTWSELTPCNAHLRDLAERVKRGVYEAGGFPVEFPVFSTGESTLRPTAMMFRN 103 +PIIGI +T E PCN HL DLA+ VK G + F + T M + Sbjct: 36 KPIIGIASTGYEGNPCNMHLNDLAKLVKEGTKNKDIIGLIFNTIGVSDGISMGTPGMRYS 95 Query: 104 LAAMDV-----EESIRGNPVDGVVLLGGCDKTTPSLLMGAASVDIPAIVVSGGPMLNGKW 158 L + D+ E ++ DG++ + GCDK P L+ ++ P+++V GG + +G Sbjct: 96 LPSRDIIADSMETVVQAMSYDGLITVVGCDKNMPGALIAMIRLNRPSVLVYGGTIDSGCH 155 Query: 159 RGKDVGSGTAIWQFSEMVKSGEMSLEEFMDAEQGMARSAGSCMTMGTASTMASMAEALGM 218 G+ + +A + V +G M E+ + + AG+C M TA+TMAS EALGM Sbjct: 156 NGQKLDVVSAFEAWGSKV-AGTMEETEYQNIVEKACPGAGACGGMYTANTMASAIEALGM 214 Query: 219 TLSGNAAIPAVDARRRVISQLTGRRIVEMVKEDLKPSDILTKEAFENAIRVNGAVGGSTN 278 TL N++ PA+ ++ S G + ++++D+KPSDI+T+++ ENA+R+ +GGSTN Sbjct: 215 TLPFNSSNPALSGAKKEESVRAGEALRLLLEKDIKPSDIITRKSLENAVRLVTILGGSTN 274 Query: 279 AVLHLLALAGRVGVDLSLDDWDRLGRDVPTIVNLQPSGKYLMEEFYYAGGLPVVIKAVAE 338 AVLH LA+A +D +L D+ + + P + +L+PSGKYLME+ + GG+P V+K + + Sbjct: 275 AVLHFLAIARAAQIDFTLKDFQDISDNTPFLADLKPSGKYLMEDVHAVGGIPAVMKYLLK 334 Query: 339 MGLLHNDAITVSGDTIWNDVKGVVNYNE--DVILPREKALTKSGGIAVLRGNLAPRGAVL 396 G+LH D +TV+G TI ++ V + E DVI E + SG + +L GNLA G+V Sbjct: 335 KGMLHGDCLTVTGKTIAENLLDVADLTEGQDVIKSIEDPIKISGHLRMLYGNLATEGSVA 394 Query: 397 KPSAASPHLMQHKGRAVVFESIEDYHARINREDLDIDETCIMVLKYCGPKGYPGMAEVGN 456 K + ++ KG+A VFE +Y A D +++ ++V++Y GPKG PGM E+ Sbjct: 395 KITGKEG--LKFKGKAKVFEG--EYAANDGIRDGLVEKGDVVVIRYEGPKGGPGMPEM-- 448 Query: 457 MGLPPKVLKKGI---TDMIRISDARMSGTAYGTVILHTAPEAAEGGPLALVENGDLIEVD 513 L P G D+ I+D R SG +G V+ H PEA EGG LALV++GD+I +D Sbjct: 449 --LKPTAAIMGAGLGKDVALITDGRFSGGTHGFVVGHITPEAQEGGNLALVKDGDVITID 506 Query: 514 IPNRTLHLHVSDEELARRRAAWVSPVKPLTGGYGGLYIKTVMQADAGADLD 564 ++ L VSD+EL +RR +W +P G Y KTV A G D Sbjct: 507 AETNSIVLEVSDQELQKRRQSWKAPDLKFKRGVLYKYAKTVSSASKGCVTD 557 Lambda K H 0.318 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 890 Number of extensions: 52 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 559 Length adjustment: 36 Effective length of query: 543 Effective length of database: 523 Effective search space: 283989 Effective search space used: 283989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory