Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 125 bits (313), Expect = 2e-33 Identities = 77/222 (34%), Positives = 119/222 (53%), Gaps = 12/222 (5%) Query: 4 IQLTDLTKRF---GDTV-AVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGD 59 I++ DL + F +TV A+ +S DI + EF+ ++G SG GKST L +L L+ PTSG Sbjct: 6 IKIEDLKREFTMGAETVRALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTSGL 65 Query: 60 IYIGG------DHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDE 113 I G +N I +FQ Y L + +N+ L ++ ER + Sbjct: 66 YEIDGVSVKDLSRNELATIRNEKIGFIFQSYNLLARTSAIENVELPLLYNSKVSTEERRK 125 Query: 114 RVVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEM 173 R +E + +G+ + LD P +LSGGQQQRVA+ R++V +P + L DE NLD + E+ Sbjct: 126 RAIEALKKVGLGERLDHTPAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLDTRTAYEI 185 Query: 174 RTELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQ 215 + Q L +Q +T +VTH + + T + R V+ DG + Q Sbjct: 186 MSIFQELNEQ-GITIAFVTHEE-DIATFSSRTIVLKDGNIIQ 225 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 247 Length adjustment: 27 Effective length of query: 356 Effective length of database: 220 Effective search space: 78320 Effective search space used: 78320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory