Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_055434784.1 ASC41_RS01020 acyl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_001418085.1:WP_055434784.1 Length = 392 Score = 400 bits (1027), Expect = e-116 Identities = 200/378 (52%), Positives = 265/378 (70%) Query: 15 LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYG 74 LD+ LTEE ++VRD+A ++ + ++P + EA + + +I + E+G G IPE+YG Sbjct: 14 LDELLTEEHKLVRDAAREWVKRDVSPIIEEAAQKAEFPKSIISGLAEIGAFGPYIPEEYG 73 Query: 75 GSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWI 134 G+GL+ + YGLI +E+ER DSG RS SVQSSLVM PI ++G E Q+ KYLPKLASGEWI Sbjct: 74 GAGLDQISYGLIMQEIERGDSGVRSTASVQSSLVMYPIWKYGNEEQRNKYLPKLASGEWI 133 Query: 135 GCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDDAGDIRGF 194 G FGLTEP+HGS+P M+T + + Y L G+KMWI+NSP +V VVWAK++ G I G Sbjct: 134 GSFGLTEPDHGSNPAGMVTNFKDMGDHYLLNGAKMWISNSPFCNVAVVWAKNEEGRIHGL 193 Query: 195 VLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYG 254 ++E+G +G + P H K LRAS TGE++ DNV VP+EN+ P+ GL P CL+SAR+G Sbjct: 194 IVERGMEGFTTPETHNKWSLRASATGELIFDNVKVPKENLLPNKSGLGAPLGCLDSARFG 253 Query: 255 ISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRM 314 I+WGA+GAA C+ TA +Y+ +R QFG+P+ QL QKKLA+M TEIT A RLG M Sbjct: 254 IAWGAIGAAMDCYDTALRYSKERLQFGKPIGQFQLQQKKLAEMITEITKAQLLAWRLGVM 313 Query: 315 KDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGT 374 ++ GTA S+ KRN+ AL IAR AR MLGG GIS E+ + RH++NLE V TYEGT Sbjct: 314 RENGTATSAQISMAKRNNVDMALTIARDARQMLGGMGISGEYSIMRHMMNLESVVTYEGT 373 Query: 375 HDVHALILGRAQTGIQAF 392 HD+H LI G TG+ AF Sbjct: 374 HDIHLLITGLDVTGLNAF 391 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 392 Length adjustment: 31 Effective length of query: 362 Effective length of database: 361 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory