Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 141 bits (356), Expect = 1e-38 Identities = 85/231 (36%), Positives = 130/231 (56%), Gaps = 13/231 (5%) Query: 12 SQALLEIRDLHKQYG----PLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEF 67 S+ +++I DL +++ + L+G+ ++ G VT++GSSGSGK+T+L + L++ Sbjct: 2 SKEIIKIEDLKREFTMGAETVRALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQP 61 Query: 68 QGGQILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLL 127 G +DG S+ N +EK+ G FQ +NL +A++NV L LL Sbjct: 62 TSGLYEIDGVSVKDLSRNELATIRNEKI--------GFIFQSYNLLARTSAIENVELPLL 113 Query: 128 KVKKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEV 187 K+ +E A + L++VGL ER DH P QLSGGQQQRVAIAR++ NP ++L DE Sbjct: 114 YNSKVSTEERRKRAIEALKKVGLGERLDHTPAQLSGGQQQRVAIARSLVNNPVMLLADEA 173 Query: 188 TSALDPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRI 238 T LD E++S+ + L E G+T+ VTHE A S + + + G I Sbjct: 174 TGNLDTRTAYEIMSIFQELNEQGITIAFVTHEEDIA-TFSSRTIVLKDGNI 223 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 247 Length adjustment: 24 Effective length of query: 241 Effective length of database: 223 Effective search space: 53743 Effective search space used: 53743 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory