Align Histidine transport ATP-binding protein HisP (characterized)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 135 bits (339), Expect = 1e-36 Identities = 88/244 (36%), Positives = 135/244 (55%), Gaps = 17/244 (6%) Query: 2 MSENKLHVIDLHKRY--GGHEV--LKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEK 57 MS+ + + DL + + G V L+G+S + G+ ++I+GSSGSGKST L + L++ Sbjct: 1 MSKEIIKIEDLKREFTMGAETVRALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQ 60 Query: 58 PSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRT-RLTMVFQHFNLWSHMTVLENVME 116 P+ G ++G ++ K +N+L +R ++ +FQ +NL + + +ENV Sbjct: 61 PTSGLYEIDGVSV----------KDLSRNELATIRNEKIGFIFQSYNLLARTSAIENVEL 110 Query: 117 APIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLL 176 + +S + R+RA++ L KVG+ ER P LSGGQQQRV+IAR+L P +LL Sbjct: 111 PLLYNSKVSTEERRKRAIEALKKVGLGERLDHT-PAQLSGGQQQRVAIARSLVNNPVMLL 169 Query: 177 FDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGD 236 DE T LD E++ I Q+L E+G T+ VTHE A SS I L G I ++ Sbjct: 170 ADEATGNLDTRTAYEIMSIFQELNEQGITIAFVTHEEDIAT-FSSRTIVLKDGNIIQDNK 228 Query: 237 PEQV 240 E V Sbjct: 229 NENV 232 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 247 Length adjustment: 24 Effective length of query: 234 Effective length of database: 223 Effective search space: 52182 Effective search space used: 52182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory