Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_055437597.1 ASC41_RS15620 acyl-CoA dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_2991 (396 letters) >NCBI__GCF_001418085.1:WP_055437597.1 Length = 600 Score = 233 bits (594), Expect = 1e-65 Identities = 136/389 (34%), Positives = 211/389 (54%), Gaps = 21/389 (5%) Query: 16 EDIDALRDAVRDFAQAEIAPRAADIDKSDQ-FPMDLWRKMGDLGVLGITVPEQYGGAAMG 74 E+ + +++AV +F EI P + D ++ RK G+LG LG+ VPE YGG MG Sbjct: 32 EEQNMMKEAVTEFNDREIIPHKPRFEAKDYALTEEVMRKAGELGFLGVAVPEAYGGLGMG 91 Query: 75 YLAHMVAMEEISRASASVGLSYGAHSNLCVNQINRNGNEAQKAKYLSKLISGEHVGALAM 134 +++ ++ + IS + S ++GAH+ + I G EAQK KY+ KL SGE G+ + Sbjct: 92 FVSTVLTCDYISSGTGSFSTAFGAHTGIGTMPITLYGTEAQKQKYVPKLASGEWFGSYCL 151 Query: 135 SEPGAGSDVISMKLKA--EDKGGYYLLNGSKMWITNGPDADTLVVYAKTEPELGARGVTA 192 +EPGAGSD S K A + G Y +NG KMWI+N ++V+A+ E + + +T Sbjct: 152 TEPGAGSDANSGKTTAVLSEDGKSYKINGQKMWISNAGFCTVMIVFARLEDD---KNITG 208 Query: 193 FLIEK-GMKGFSIAQKLDKLGMRGSHTGELVFQDVEVPAENVLGGLNQGAKVLMSGLDYE 251 F++E G ++ ++ KLG+R S T ++ F D VP EN+L G +G K+ M+ L+ Sbjct: 209 FIVENDAANGITMGEEEHKLGIRASSTRQVFFNDTVVPIENMLAGRGEGFKIAMNALNVG 268 Query: 252 RAVLTGGPLGIMQSVMDNVIPYIHDRKQFGQSIGEFQLIQGKVADMYTVLQAGRSFAYTV 311 R L L + ++ + + Y +RKQF I +F I+ K+A+M T AG S Y Sbjct: 269 RIKLAAACLDSQRRIVTHGVKYAMERKQFKTPIADFGAIKMKLAEMATNAYAGESATYRA 328 Query: 312 AKNL-------DMLGTDH-------VRQVRKDCASVILWCAEKATWMAGEGVQIYGGNGY 357 AKN+ + G H V + +C+ + + +E A EG+QI+GG G+ Sbjct: 329 AKNIEDRIALREAAGNTHQEAELKGVEEYAIECSILKVAVSEDVQNCADEGIQIFGGMGF 388 Query: 358 INEYPLGRLWRDAKLYEIGAGTSEIRRML 386 E P+ WRDA++ I GT+EI RML Sbjct: 389 SEETPMESAWRDARIARIYEGTNEINRML 417 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 600 Length adjustment: 34 Effective length of query: 362 Effective length of database: 566 Effective search space: 204892 Effective search space used: 204892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory