Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 104 bits (260), Expect = 2e-27 Identities = 74/207 (35%), Positives = 105/207 (50%), Gaps = 13/207 (6%) Query: 20 KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERG--- 76 + I+ DI EGEFV +G SG GKST+L ++ L+ TSG I + D E Sbjct: 26 RGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTSGLYEIDGVSVKDLSRNELATIR 85 Query: 77 ---VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ---LAHLLDRK 130 +G +FQSY L S EN+ L L K +R + E L+ L LD Sbjct: 86 NEKIGFIFQSYNLLARTSAIENVE--LPLLYNSKVSTEERRKRAIEALKKVGLGERLDHT 143 Query: 131 PKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV 190 P LSGGQ+QRVAI R+LV P + L DE NLD ++ L+++ G T+ +V Sbjct: 144 PAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLDTRTAYEIMSIFQELNEQ-GITIAFV 202 Query: 191 THDQVEAMTLADKIVVLDAGRVAQVGK 217 TH++ + T + + +VL G + Q K Sbjct: 203 THEE-DIATFSSRTIVLKDGNIIQDNK 228 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 247 Length adjustment: 27 Effective length of query: 344 Effective length of database: 220 Effective search space: 75680 Effective search space used: 75680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory