Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_055435228.1 ASC41_RS03330 SDR family oxidoreductase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_001418085.1:WP_055435228.1 Length = 254 Score = 119 bits (299), Expect = 5e-32 Identities = 83/250 (33%), Positives = 131/250 (52%), Gaps = 8/250 (3%) Query: 6 NGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLTI 65 +GKV +TG GIG +A + ++G V++N + +E A+ K L +E E Sbjct: 5 SGKVAIVTGATGGIGFEVAKRLGKDGYTVILNGIDNEAGAEKLKMLTDEGITAEYYGF-- 62 Query: 66 PGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFRE-FLEITPETLFQTVNINLNGAF 124 D++ E ++ K+G I+V V+NAG G R F E+T E + + +NL+ F Sbjct: 63 --DVTSEEAVTSNIQAIGNKYGRIDVLVNNAGGLGGRSRFEEMTTEFYRKVMALNLDSVF 120 Query: 125 FAIQAAAQQMVKQGKGGSIIGISSISA-LVGGAHQTHYTPTKAGILSLMQSTACALGKYG 183 FA +AA +K G+ SII +S + GG Y +KAG+ ++ ++ A L +YG Sbjct: 121 FASRAAIP-FLKNGEHPSIINYTSNAGWTAGGPGAGIYGTSKAGVHAITRAFAKDLAEYG 179 Query: 184 IRCNAILPGTISTALNEE-DLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYV 242 IR NA+ PGTI T + + PE I LGR+G P+D+AG FLAS ++++ Sbjct: 180 IRVNAVSPGTIDTPFHAQIKATKPEVFASWANNIMLGRLGQPEDVAGVVSFLASKDASFI 239 Query: 243 NGAQLLVDGG 252 + + GG Sbjct: 240 TAETIQIGGG 249 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 254 Length adjustment: 24 Effective length of query: 234 Effective length of database: 230 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory