Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= TCDB::Q9R9Q4 (342 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 118 bits (295), Expect = 2e-31 Identities = 79/225 (35%), Positives = 123/225 (54%), Gaps = 18/225 (8%) Query: 4 LQLRDIRKSF--GAFDV--IKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGT 59 +++ D+++ F GA V ++G+S +IK GEF+ +G SG GKST+L ++ L++ TSG Sbjct: 6 IKIEDLKREFTMGAETVRALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTSGL 65 Query: 60 LAFDGQIVNQL------TPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAGK-DKQQCRK 112 DG V L T I +FQSY L + EN+ + K ++ RK Sbjct: 66 YEIDGVSVKDLSRNELATIRNEKIGFIFQSYNLLARTSAIENVELPLLYNSKVSTEERRK 125 Query: 113 RVEAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVAT 172 R A + + L L+ P QLSGGQ+QRVAI R++V +P + L DE NLD T Sbjct: 126 RAIEALKKVGLGERLDHTPAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLD----TRT 181 Query: 173 RLEIAKLHRSMHK--TTMIYVTHDQVEAMTLADRICVLRDGLVEQ 215 EI + + +++ T+ +VTH++ + T + R VL+DG + Q Sbjct: 182 AYEIMSIFQELNEQGITIAFVTHEE-DIATFSSRTIVLKDGNIIQ 225 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 247 Length adjustment: 26 Effective length of query: 316 Effective length of database: 221 Effective search space: 69836 Effective search space used: 69836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory