Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= TCDB::Q00752 (377 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 103 bits (257), Expect = 5e-27 Identities = 71/211 (33%), Positives = 111/211 (52%), Gaps = 17/211 (8%) Query: 20 SVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKGELKIDGEVVNDKAP----- 74 ++ DIK EF+ +G SG GKST L ++ L+ T G +IDG V D + Sbjct: 24 ALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTSGLYEIDGVSVKDLSRNELAT 83 Query: 75 -KDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAAQIL---GLTEFLE 130 ++ I +FQ+Y L S +N+ L L + SK + ++R K A + L GL E L+ Sbjct: 84 IRNEKIGFIFQSYNLLARTSAIENVE--LPLLYNSKVSTEERRKRAIEALKKVGLGERLD 141 Query: 131 RKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTI 190 PA LSGGQ+QRVA+ R++V + + L DE NLD + + + +++ + G T Sbjct: 142 HTPAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLDTRTAYEIMSIFQELNEQ-GITIA 200 Query: 191 YVTHDQTEAMTLADRIV-----IMSSTKNED 216 +VTH++ A + IV I+ KNE+ Sbjct: 201 FVTHEEDIATFSSRTIVLKDGNIIQDNKNEN 231 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 247 Length adjustment: 27 Effective length of query: 350 Effective length of database: 220 Effective search space: 77000 Effective search space used: 77000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory