Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 123 bits (309), Expect = 3e-33 Identities = 84/241 (34%), Positives = 132/241 (54%), Gaps = 8/241 (3%) Query: 5 QLISVEDIVFRYRKDAER-RALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPES 63 ++I +ED+ + AE RAL G+S + EGE++ I+G +GSGKST+ L L P S Sbjct: 4 EIIKIEDLKREFTMGAETVRALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTS 63 Query: 64 GDIEVAGIQLTEESVWEV----RKKIGMVFQNPDNQFVGTTVRDDVAFGL-ENNGVPREE 118 G E+ G+ + + S E+ +KIG +FQ+ N T+ ++V L N+ V EE Sbjct: 64 GLYEIDGVSVKDLSRNELATIRNEKIGFIFQSY-NLLARTSAIENVELPLLYNSKVSTEE 122 Query: 119 MIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGR 178 +R A+K+V + + LD P LSGGQ+QRVAIA + P +++ DEAT LD Sbjct: 123 RRKRAIEALKKVGLGERLDHTPAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLDTRTA 182 Query: 179 EEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIFKLNKELVR 238 E++ + L EQG+ T+ +TH+ + A + R IV+ G + E + EL + Sbjct: 183 YEIMSIFQELNEQGI-TIAFVTHEEDIATFSSRTIVLKDGNIIQDNKNENVQSAKVELAK 241 Query: 239 I 239 + Sbjct: 242 L 242 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 247 Length adjustment: 25 Effective length of query: 256 Effective length of database: 222 Effective search space: 56832 Effective search space used: 56832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory