Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate WP_055437409.1 ASC41_RS13385 ABC transporter ATP-binding protein
Query= uniprot:P70970 (276 letters) >NCBI__GCF_001418085.1:WP_055437409.1 Length = 247 Score = 118 bits (296), Expect = 1e-31 Identities = 77/204 (37%), Positives = 117/204 (57%), Gaps = 5/204 (2%) Query: 9 ALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLK 68 AL I+ IKEG +V ++G +GSGKST+L L L +PT G + ++ +N+ Sbjct: 24 ALRGISFDIKEGEFVTIMGSSGSGKSTMLNILGCLDQPTSGLYEIDGVSVKDLSRNELAT 83 Query: 69 KLRKKVGIVFQFPEHQLFEETVLKDISFGPM-NFGVKKEDAEQKAREMLQLVGLSEELLD 127 +K+G +FQ + L + ++++ + N V E+ ++A E L+ VGL E L D Sbjct: 84 IRNEKIGFIFQ-SYNLLARTSAIENVELPLLYNSKVSTEERRKRAIEALKKVGLGERL-D 141 Query: 128 RSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTI 187 +P +LSGGQ +RVAIA L +P +L+ DE T LD R EIM +F EL+++G +T Sbjct: 142 HTPAQLSGGQQQRVAIARSLVNNPVMLLADEATGNLDTRTAYEIMSIFQELNEQG-ITIA 200 Query: 188 LVTHSMEDAAAYADEMIVMHKGTI 211 VTH ED A ++ IV+ G I Sbjct: 201 FVTHE-EDIATFSSRTIVLKDGNI 223 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 247 Length adjustment: 25 Effective length of query: 251 Effective length of database: 222 Effective search space: 55722 Effective search space used: 55722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory