Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_055442848.1 AMD28_RS03840 ATP-binding cassette domain-containing protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_001418105.1:WP_055442848.1 Length = 256 Score = 129 bits (323), Expect = 8e-35 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 8/217 (3%) Query: 14 IIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQGRIVV 73 +I+++ ++K +G H+LK I + G+ ++ G SGSGK+ ++CL L E +G I Sbjct: 1 MIEVKDLHKSFGDAHILKGITTTFENGKTSLVIGQSGSGKTVFLKCLLGLFEKDEGSISY 60 Query: 74 DGV---ELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEIA 130 DG EL+ D K+ +R E+GMVFQ LF +TI +N K K + E+ Sbjct: 61 DGKIYSELSTDQKR--DLRSEMGMVFQGSALFDSMTIAENVMFPLRMFTKQSKSEMEDRV 118 Query: 131 MHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEVLD 190 L+RV +P+ +K P + SGG Q+RVAIARA+ PK + DEP S LDP+ V+D Sbjct: 119 NFVLKRVNLPDAHNKMPSEASGGMQKRVAIARAIVNNPKYLFCDEPNSGLDPK-TAIVID 177 Query: 191 TMIGLAED--GMTMLCVTHEMGFARTVANRVIFMDKG 225 +I D +T + TH+M + +++F+ G Sbjct: 178 NLIQEITDEYDITTIINTHDMNSVMEIGEKIVFLKDG 214 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 256 Length adjustment: 24 Effective length of query: 230 Effective length of database: 232 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory