Align Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized)
to candidate WP_055442848.1 AMD28_RS03840 ATP-binding cassette domain-containing protein
Query= SwissProt::P9WQI3 (393 letters) >NCBI__GCF_001418105.1:WP_055442848.1 Length = 256 Score = 124 bits (310), Expect = 4e-33 Identities = 69/226 (30%), Positives = 124/226 (54%), Gaps = 7/226 (3%) Query: 4 IVLDHVNKSYPDGHTAVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSGELRI 63 I + ++KS+ D H ++ + T +G+ +++G SG GKT L + GL + G + Sbjct: 2 IEVKDLHKSFGDAHI-LKGITTTFENGKTSLVIGQSGSGKTVFLKCLLGLFEKDEGSISY 60 Query: 64 AGERVNEKAPKDR-----DIAMVFQSYALYPHMTVRQNIAFPLTL-AKMRKADIAQKVSE 117 G+ +E + + ++ MVFQ AL+ MT+ +N+ FPL + K K+++ +V+ Sbjct: 61 DGKIYSELSTDQKRDLRSEMGMVFQGSALFDSMTIAENVMFPLRMFTKQSKSEMEDRVNF 120 Query: 118 TAKILDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEI 177 K ++L + ++ PS+ SGG ++RVA+ RAIV +PK DEP S LD K + + I Sbjct: 121 VLKRVNLPDAHNKMPSEASGGMQKRVAIARAIVNNPKYLFCDEPNSGLDPKTAIVIDNLI 180 Query: 178 AQLQRRLGTTTVYVTHDQTEAMTLGDRVVVMYGGIAQQIGTPEELY 223 ++ TT+ THD M +G+++V + G+ G+ E ++ Sbjct: 181 QEITDEYDITTIINTHDMNSVMEIGEKIVFLKDGLKAWEGSKENIF 226 Lambda K H 0.319 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 256 Length adjustment: 27 Effective length of query: 366 Effective length of database: 229 Effective search space: 83814 Effective search space used: 83814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory