GapMind for catabolism of small carbon sources

 

Protein WP_058859597.1 in Kocuria flava HO-9041

Annotation: NCBI__GCF_001482365.1:WP_058859597.1

Length: 277 amino acids

Source: GCF_001482365.1 in NCBI

Candidate for 30 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
trehalose catabolism thuG hi Trehalose transport system permease protein SugB (characterized) 57% 100% 323.2 PalG, component of Palatinose (isomaltulose; 6-O-α-D-glucopyranosyl-D-fructose) uptake porter 39% 197.2
D-maltose catabolism thuG med Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 43% 97% 224.9 Trehalose transport system permease protein SugB 57% 323.2
sucrose catabolism thuG med Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 43% 97% 224.9 Trehalose transport system permease protein SugB 57% 323.2
xylitol catabolism Dshi_0549 lo ABC transporter for Xylitol, permease component 2 (characterized) 35% 99% 164.5 Trehalose transport system permease protein SugB 57% 323.2
L-fucose catabolism SM_b21105 lo ABC transporter for L-Fucose, permease component 2 (characterized) 33% 92% 153.7 Trehalose transport system permease protein SugB 57% 323.2
D-cellobiose catabolism msdB2 lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 31% 97% 151.8 Trehalose transport system permease protein SugB 57% 323.2
D-sorbitol (glucitol) catabolism mtlG lo ABC transporter for D-Sorbitol, permease component 1 (characterized) 32% 89% 151.4 Trehalose transport system permease protein SugB 57% 323.2
D-glucosamine (chitosamine) catabolism SM_b21219 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 33% 95% 148.7 Trehalose transport system permease protein SugB 57% 323.2
D-maltose catabolism malG_Bb lo ABC-type Maltose/ Maltodextrin permease (characterized, see rationale) 32% 99% 146.7 Trehalose transport system permease protein SugB 57% 323.2
D-mannitol catabolism mtlG lo ABC transporter for D-mannitol and D-mannose, permease component 2 (characterized) 32% 94% 142.9 Trehalose transport system permease protein SugB 57% 323.2
N-acetyl-D-glucosamine catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 31% 84% 142.5 Trehalose transport system permease protein SugB 57% 323.2
D-glucosamine (chitosamine) catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 31% 84% 142.5 Trehalose transport system permease protein SugB 57% 323.2
D-maltose catabolism malG lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 31% 98% 133.3 Trehalose transport system permease protein SugB 57% 323.2
xylitol catabolism HSERO_RS17010 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 33% 96% 132.9 Trehalose transport system permease protein SugB 57% 323.2
D-cellobiose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
D-glucose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
lactose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
D-maltose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
D-mannose catabolism TT_C0326 lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
sucrose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
trehalose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 31% 100% 131 Trehalose transport system permease protein SugB 57% 323.2
D-cellobiose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
D-glucose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
lactose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
D-maltose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
D-maltose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
sucrose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
sucrose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
trehalose catabolism aglG lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2
trehalose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 31% 61% 112.8 Trehalose transport system permease protein SugB 57% 323.2

Sequence Analysis Tools

View WP_058859597.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTKQKLGWAVVSVLVLVYALFPVASILMTSFKSPSDLTSGKFLPTRWVGENYEMIFVGS
ARDLFVPALINSIGISLIATFIAVVLATFCAYAIARLDFPGKKLILTVALAVSVFPVISV
VTPLFNLWRQIGLYDTWPGLIIPYLSLTLPISIWTLTAFFQQIPWDLERAAQVDGATTWQ
AFRKVIVPLAAPGVFTTAIIAFFIAWNDFVYGIGLTSTEAARPVPAALAFFTGASQFEDP
AGAISAAAIIVTIPVVLLVLLFQRQIVSGLTQGAVKG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory