GapMind for catabolism of small carbon sources

 

Protein WP_083529347.1 in Kocuria flava HO-9041

Annotation: NCBI__GCF_001482365.1:WP_083529347.1

Length: 359 amino acids

Source: GCF_001482365.1 in NCBI

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism PA5503 med Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 46% 97% 262.7 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 41% 100% 188 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 41% 100% 188 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-glutamate catabolism gltL med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 41% 100% 188 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 42% 96% 187.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 40% 100% 184.5 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 42% 90% 178.3 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 40% 87% 170.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 40% 87% 170.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 42% 87% 169.5 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-histidine catabolism hisP med histidine transport ATP-binding protein hisP (characterized) 40% 93% 169.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 40% 89% 167.5 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 40% 86% 157.9 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-histidine catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 41% 81% 155.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 41% 81% 155.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 99% 181 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 99% 181 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 39% 99% 179.9 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 42% 60% 178.3 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 99% 177.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 99% 177.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 37% 62% 175.3 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 40% 90% 167.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 89% 165.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 89% 165.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 89% 165.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 89% 165.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 89% 165.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 37% 95% 156 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 37% 91% 150.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 39% 80% 150.2 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 92% 127.9 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 92% 127.9 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 92% 127.9 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 86% 108.6 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-alanine catabolism braF lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-isoleucine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-leucine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-proline catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-serine catabolism braF lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-threonine catabolism braF lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
L-valine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 86% 105.1 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3
D-lactate catabolism PGA1_c12640 lo D-lactate transporter, ATP-binding component (characterized) 32% 94% 102.8 Methionine import ATP-binding protein metN, component of L-Methionine uptake porter, MetQNI 53% 366.3

Sequence Analysis Tools

View WP_083529347.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSAAEPGRPGPPGRPGEVLVSFREVSKVFRTGSGRAAREVRAVDDVTLDVHRGEIFGVIG
YSGAGKSTLVRLINGLEPVTSGSLTVAGVEVAGRTETELAPVRRDIGMIFQQFNLFTSRT
VAGNVEYPLKRAGWDKERRRERVAELLEFVGLASRAGNYPEQLSGGQKQRVGIARALATS
PELLLADESTSALDPETTQEVLQLLQRVNRELGITIVIITHEMDVVRTIADRVAVMQDGR
VVEHGPTVDIFARPRTETARRFVSSVMHTVPDERDLERLRRAHRGRLVIVDVGDGIDIGG
PLSDGAAHGVRFTIAYGGISVLQEQSFGSLTLELTGPDPAVQDVVEQLARVTEVREVAA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory