Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_058859370.1 AS188_RS14075 3-oxoacid CoA-transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_001482365.1:WP_058859370.1 Length = 230 Score = 248 bits (632), Expect = 8e-71 Identities = 132/211 (62%), Positives = 155/211 (73%), Gaps = 2/211 (0%) Query: 2 TITKKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYL-GDKEVFLHSENGLLGMGPSP 60 T L E+A+ VAADI G+YVNLGIG PTLVAN+L + +V LH+ENG+LGMG Sbjct: 16 TAEHPLGPEELARVVAADIPAGSYVNLGIGQPTLVANHLTAEHDVTLHTENGMLGMGREA 75 Query: 61 APGEEDDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWH 120 E D DLINAGK V G ++FHHADSF+MMRGGHLD VLGAFQV V+G+LANWH Sbjct: 76 HGDEVDPDLINAGKIPVVETPGCSYFHHADSFAMMRGGHLDCCVLGAFQVDVEGNLANWH 135 Query: 121 TGAEGSIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLA 180 TG +IPAVGGAMDLATGA+Q FVMM LTK G+SKLV +CT PLTG+ CVSR+YTD A Sbjct: 136 TGKPEAIPAVGGAMDLATGAKQTFVMMTLLTKKGQSKLVEKCTMPLTGVGCVSRVYTDRA 195 Query: 181 VLEVTPEGLKVVEICADIDFDELQKLSGVPL 211 V V +GL V E DF+ELQ+L G+PL Sbjct: 196 VFLVDEDGLSVRETFG-TDFEELQELVGLPL 225 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 230 Length adjustment: 22 Effective length of query: 191 Effective length of database: 208 Effective search space: 39728 Effective search space used: 39728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory