Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_058857324.1 AS188_RS01320 D-2-hydroxyacid dehydrogenase
Query= curated2:Q9YAW4 (335 letters) >NCBI__GCF_001482365.1:WP_058857324.1 Length = 327 Score = 109 bits (273), Expect = 8e-29 Identities = 93/279 (33%), Positives = 134/279 (48%), Gaps = 22/279 (7%) Query: 61 DLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRV 120 D A L V A G D++ + + VTN G AEF A +LA +++ Sbjct: 63 DAWPHAGSLEWVHVAAAGVDSLLFDGLRASDVVVTNAHGAFDGPIAEFVLASVLAHDKQL 122 Query: 121 VEADHFVRWGEWWRLRTGWHPMMMLGVELR---GKTLGILGMGRIGSRVAEIGKAFGMRI 177 + R G W R R ELR G+ ++G G IG A + +A G+ + Sbjct: 123 HPSKELQRRGVW-RHR-----------ELRRTAGRHALVVGTGGIGRATARLLRAVGLEV 170 Query: 178 IYHSRSRKREIEKELGAEYRSLEDLLRE----SDILSIHLPLTDETRHLIGESELKLMKK 233 R+ RE + + G S E L E +D L + PLT++TR + G M+ Sbjct: 171 RGAGRAA-REDDPDFGTVVPSAE--LAEHAGWADHLVLIAPLTEDTRGIAGAEVFAAMRP 227 Query: 234 TAILVNTGRGAIVDTGALVKALREGWIAAAALDVFEEEPLNPNHPLTAFKNVVLAPHAAS 293 TA LVN GRGA+VD ALV+AL+ IAAA+LDVF EEPL HP NV ++ H + Sbjct: 228 TAHLVNVGRGALVDEPALVRALQRDEIAAASLDVFAEEPLPAEHPFWRMDNVHVSAHMSG 287 Query: 294 ATRETRLRMAMMAAENLVAFAQGKVPPNLVNREVVKVRQ 332 R +A A+NL + G+ N V++++ VR+ Sbjct: 288 DVVGWRDTLADQFADNLARWCAGEDLVNQVDKQLGWVRR 326 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 327 Length adjustment: 28 Effective length of query: 307 Effective length of database: 299 Effective search space: 91793 Effective search space used: 91793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory