Align Citrate-proton symporter; Citrate carrier protein; Citrate transporter; Citrate utilization determinant; Citrate utilization protein A (characterized)
to candidate WP_058859649.1 AS188_RS01290 MFS transporter
Query= SwissProt::P0A2G3 (434 letters) >NCBI__GCF_001482365.1:WP_058859649.1 Length = 449 Score = 201 bits (511), Expect = 4e-56 Identities = 124/409 (30%), Positives = 201/409 (49%), Gaps = 18/409 (4%) Query: 16 AILRVTSGNFLEQFDFFLFGFYATYIARTFFPAESEFASLMLTFAVFGSGFLMRPVGAIV 75 A+ GN E FD+ ++ YI + FFP E +L + F FL+RP+G + Sbjct: 20 AVAASAIGNATEWFDYGVYAVSVVYITQNFFPGEY---GTILALSTFAFSFLVRPLGGLF 76 Query: 76 LGAYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYQTIGLAAPALVLLGRLLQGFSAGVEL 135 G DR+GR++ L +T+ +M T I L+P +TIG+AAP L++L R +QGFS G E Sbjct: 77 WGPLGDRLGRKRILALTIILMAGATFCIGLLPTVETIGIAAPILLILLRAVQGFSTGGEY 136 Query: 136 GGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYSLNITLGHDAISEWGWRIPFF 195 GG + +++E A +GF S+ + +LI + LG+DA+SEWGWRIPF Sbjct: 137 GGAATFMAEYAPDKRRGFLGSFLEFGTLAGFALGSLIVLLGEVVLGNDAMSEWGWRIPFL 196 Query: 196 IGCMIIPLIFVLRRSLQETEAFLQRKHRPDTRE-----IFATIAKNWRIITAGTLLVAMT 250 + + + LR L ++ F + + T + + + WR + T LV Sbjct: 197 LAGPMGLVGLYLRSRLADSPVFQELEESGHTESSAGMALKDLVTRYWRPMLIMTGLVIAL 256 Query: 251 TTTFYFITVYTPTYGRTVLNLSARDSLIVTMLVGVSNFIWLPIGGAISDRIGRRAV---- 306 Y + Y PTY ++ R L + + + + +P GA+SDR+GR+ + Sbjct: 257 NVVNYTLLSYMPTYLEGQTGMANRTVLTIMFVAQFAMMLVIPFAGALSDRVGRKPMWYTS 316 Query: 307 LMGITLLALITTWPVMQWLTAAPDFTRMTLVLLWFSFFFGMYNGAMVAALTEVMPVYVRT 366 L+G+ +LA + ++ A F L + + A + P VR Sbjct: 317 LIGLFVLA------IPMYMLMANGFWWALLGFAVLGLLYIPQLATISATFPAMFPTQVRY 370 Query: 367 VGFSLAFSLATAIFGGLTPAISTALVKLTGDKSSPGWWLMCAALCGLAA 415 GF++ ++LATA+FGG P + AL+ TG+ P +++M A + GL A Sbjct: 371 AGFAITYNLATAVFGGTAPLANEALIGATGNPLVPAFYMMAACVVGLVA 419 Lambda K H 0.329 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 539 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 449 Length adjustment: 32 Effective length of query: 402 Effective length of database: 417 Effective search space: 167634 Effective search space used: 167634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory