Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_058857809.1 AS188_RS04270 acetoin reductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_001482365.1:WP_058857809.1 Length = 259 Score = 121 bits (304), Expect = 1e-32 Identities = 84/251 (33%), Positives = 124/251 (49%), Gaps = 6/251 (2%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGT----VATRADVSDAAQ 71 L++G GIG+ +A + G V + D+ + + T A ADVSD Sbjct: 9 LVTGAGRGIGKAIALRLAQDGFDVGLVDLRDELTREVLGEIEATGRRACAVTADVSDRDS 68 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISD-AEWQATININLTAQYRFAHHAVP 130 + A + E LG LDV+VNNAGIA ++ D E +NIN + A Sbjct: 69 VRAAVQEVAERLGRLDVMVNNAGIAQVQPILEVTPDEVETIERVNIN-GVLWGIQAAAAR 127 Query: 131 MLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGI 190 L++ + G +++ AS+AG G+A Y+ATK+A+ GL ++ A EL I VNA PG+ Sbjct: 128 FLEQGTRGKIINAASIAGHEGFAVLGVYSATKFAVRGLTQAAAKELAPHGITVNAYCPGV 187 Query: 191 VEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTG 250 V + AE G + ++Y+ I+L R T EDVAA +L P A +TG Sbjct: 188 VGTDMWVEIDERFAELTGAEKGATYEQYVGGIALGRAQTPEDVAAFVSYLAGPDADYMTG 247 Query: 251 QAISVDGNVEY 261 QA +DG + Y Sbjct: 248 QAPLIDGGLVY 258 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory