Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate WP_058858206.1 AS188_RS06715 5-dehydro-2-deoxygluconokinase
Query= SwissProt::A2WXV8 (323 letters) >NCBI__GCF_001482365.1:WP_058858206.1 Length = 328 Score = 129 bits (324), Expect = 1e-34 Identities = 97/321 (30%), Positives = 149/321 (46%), Gaps = 18/321 (5%) Query: 8 VVSFGEMLIDFVPTVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEFG 67 VV+ G + +D P G+ L + +F K GG+PANVA+A AR G AA + + G+D FG Sbjct: 5 VVTMGRISVDIYPNEIGMGLEDVTSFGKYLGGSPANVAVAAARHGESAALISRTGEDPFG 64 Query: 68 RMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADGEREFMFY-RNPSA-DMLLTHAELN 125 L L GVDD V G +T F + + FY R P+A D+ + E++ Sbjct: 65 TYLHRELVRYGVDDTFVTPVPGLQTPATFCAIMPPEDFPLYFYGRFPTAPDLQIRPEEID 124 Query: 126 VELIKRAAVFHYGSISLIAEPCRSAHLRA------MEIAKEAGALLSYDPNLREALWPSR 179 ++ A + L EP RSA L A ++ + +L D R W S Sbjct: 125 TATVRDARILWSTVTGLCQEPSRSAQLAAHTARPREQLRPDQHTVLDLD--YRPMFWASE 182 Query: 180 EEARTKILSIWDHADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKY 239 EEAR ++ + H I ++ E G + D+ +L +++ +V LG +G Sbjct: 183 EEAREQVHELLRHVSIAIGNDKECAVAVG-EGTPDEQADRLLEAGVRIAVVKLGPEGVMA 241 Query: 240 YARDFRGAVPSYKVQQVDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANACGAI 299 R+ R V+ V+ GAGD+F GA L LE+ + +ANA GAI Sbjct: 242 KTREERVVSAPVPVETVNGLGAGDSFGGAFCH-------GLNQGWPLEQVLDYANAAGAI 294 Query: 300 TATKKGAIPSLPTEVEVLKLM 320 A++ ++PT EV +L+ Sbjct: 295 VASRISCSDAMPTPDEVFQLL 315 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 328 Length adjustment: 28 Effective length of query: 295 Effective length of database: 300 Effective search space: 88500 Effective search space used: 88500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory