Align Butyrate--acetoacetate CoA-transferase subunit B; Short=Coat B; EC 2.8.3.9 (characterized, see rationale)
to candidate WP_058859370.1 AS188_RS14075 3-oxoacid CoA-transferase subunit B
Query= uniprot:P23673 (221 letters) >NCBI__GCF_001482365.1:WP_058859370.1 Length = 230 Score = 147 bits (372), Expect = 1e-40 Identities = 81/206 (39%), Positives = 122/206 (59%), Gaps = 3/206 (1%) Query: 7 LAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEA 66 L E +A+ VA ++ G VNLG+G PT+VA+++ +T +ENG++GMG +E Sbjct: 21 LGPEELARVVAADIPAGSYVNLGIGQPTLVANHLTAEHDVTLHTENGMLGMGREAHGDEV 80 Query: 67 DKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIV-PGK 125 D D++NAG P ++F + SF+++RGGH+D VLGA QVD +GN+ANW + Sbjct: 81 DPDLINAGKIPVVETPGCSYFHHADSFAMMRGGHLDCCVLGAFQVDVEGNLANWHTGKPE 140 Query: 126 MLSGMGGAMDLVNGAKKVIIAMR-HTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVI 184 + +GGAMDL GAK+ + M T KGQ K+++KCT+PLT + + T+ V V Sbjct: 141 AIPAVGGAMDLATGAKQTFVMMTLLTKKGQSKLVEKCTMPLTGVGCVSRVYTDRAVFLVD 200 Query: 185 NDGLLLTEINKNTTIDEIRSLTAADL 210 DGL + E T +E++ L L Sbjct: 201 EDGLSVRE-TFGTDFEELQELVGLPL 225 Lambda K H 0.316 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 221 Length of database: 230 Length adjustment: 22 Effective length of query: 199 Effective length of database: 208 Effective search space: 41392 Effective search space used: 41392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory