Align BadH (characterized)
to candidate WP_058857822.1 AS188_RS04345 SDR family oxidoreductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_001482365.1:WP_058857822.1 Length = 258 Score = 142 bits (359), Expect = 5e-39 Identities = 94/256 (36%), Positives = 141/256 (55%), Gaps = 16/256 (6%) Query: 7 KTAVITGGGG--GIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGT-AEAVRCD 63 +TAV+TG GIG AT A +G +AV D++ D A A I + G A +R D Sbjct: 11 RTAVLTGAASPRGIGRATADLLASQGWAVAVLDVDGDEAAAAAREIAERHGVPALGLRTD 70 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKP---FTKTEPGEWERLIAINLTGALH 120 + D S++AAI L V LVN AG I P +T+ G WER+ A+N+TG Sbjct: 71 VTDEASIEAAIGRVEAELPAVVALVNCAG--ISSPTDVMDETKEG-WERVFAVNMTGTFL 127 Query: 121 MHHAVLPGMVERRHGRIVNIASDAARVGSS--GEAVYAACKGGLVAFSKTLAREHARHGI 178 + VL GM+ER+ GR+V+I+S +A+ G ++ Y+A K ++ F++ +ARE H I Sbjct: 128 VTQRVLRGMIERKLGRVVSISSISAQRGGGTYSKSAYSASKAAIIGFTRAVAREMGEHNI 187 Query: 179 TVNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAG 238 TVN + PG DT D+ G + E+ A + I + R+G ++A +AF +DAG Sbjct: 188 TVNCIAPGAVDT----DIMGGTLSDERK-AAMAQDILVRRVGAVREIAALLAFLVGEDAG 242 Query: 239 FITGQVLSVSGGLTMN 254 +IT V+GGL ++ Sbjct: 243 YITAATYDVNGGLQIS 258 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 258 Length adjustment: 24 Effective length of query: 231 Effective length of database: 234 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory