Align BadK (characterized)
to candidate WP_058860026.1 AS188_RS15825 hypothetical protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_001482365.1:WP_058860026.1 Length = 267 Score = 127 bits (320), Expect = 2e-34 Identities = 86/255 (33%), Positives = 123/255 (48%), Gaps = 14/255 (5%) Query: 9 ETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIA 68 E G V ++TL+ N L L L L D +GA+V+ G F+ G D+A Sbjct: 18 ERTGAVAVVTLDDERRRNVLGAELRTRLRAVLAELAVDPAVGAVVLTGAGGCFSGGGDLA 77 Query: 69 SM-------AAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVI 121 SM +A ++V G + + KPV+AAV G A G L CD+V+ Sbjct: 78 SMPPAGPAESAARMAEVAGLVL------ELASLEKPVVAAVTGPAAGVAVGLVCCCDVVV 131 Query: 122 AGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVV 181 AG SA+F P +LGL P G L + G A+A + L A P++A A GL VV Sbjct: 132 AGESARFLFPFTRLGLAPDGGLVHSLTQRTGAARARRILLEAAPVDAATALETGLADHVV 191 Query: 182 DDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAR 241 D + D VA A +A + A+ A+K + A +L + + FER A F ++D Sbjct: 192 PDREVLDAAVARAGELAGRAPLAVAAVKRGIREA-SGSLEDALAFEREHQPALFGTSDFL 250 Query: 242 EGIQAFLEKRAPCFS 256 EG Q+F ++R P FS Sbjct: 251 EGKQSFFDRRVPSFS 265 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 267 Length adjustment: 25 Effective length of query: 233 Effective length of database: 242 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory