Align ring 1,2-phenylacetyl-CoA epoxidase PaaA subunit (EC 1.14.13.149) (characterized)
to candidate WP_083529125.1 AS188_RS01190 1,2-phenylacetyl-CoA epoxidase subunit A
Query= metacyc::MONOMER-15947 (330 letters) >NCBI__GCF_001482365.1:WP_083529125.1 Length = 338 Score = 441 bits (1134), Expect = e-128 Identities = 217/321 (67%), Positives = 250/321 (77%), Gaps = 7/321 (2%) Query: 8 TGVKRVKALE--EMAPEERAFQERIDAEI----KIEAKNWMPDAYRQTLIRQISQHAHSE 61 TG+ V A + E A ERA QE D I +IE ++WMP AYR+TL+RQ+SQHAHSE Sbjct: 6 TGLHAVPAADAAEQAEAERAGQEHFDRIIAEDSRIEPRDWMPAAYRKTLVRQVSQHAHSE 65 Query: 62 IVGMLPEGNWVTRAPTLKRKLQLMAKIQDEAGHGLYLYSAMETLGADRDEEIAKLHSGKA 121 I+GM PEGNW++RAP+LKRK LMAK+QDEAGHGLYLYSA ETLG R E +L G+A Sbjct: 66 IIGMQPEGNWISRAPSLKRKAILMAKVQDEAGHGLYLYSAAETLGTPRHELNQQLLEGRA 125 Query: 122 KYSSIFNYPTLNWADMGAVGWLVDGAAIVNQVVLQRTSYGPYSRAMIRICKEESFHQRQG 181 KYSSIFNYP WADMGA+GWLVDGAAI NQV L R SYGPY RAM+RICKEESFHQRQG Sbjct: 126 KYSSIFNYPARTWADMGAIGWLVDGAAIANQVPLCRASYGPYGRAMVRICKEESFHQRQG 185 Query: 182 YEILLTMMRHGTQAQKDMVQDAINRLWWPALMMFGPSDEHSPNSAQSMAWKIKRQSNDEL 241 +EIL + HGT AQK M QDA+NR + PAL MFGP DE SPNS QSMAW IKR SNDEL Sbjct: 186 WEILYE-LSHGTPAQKKMAQDAVNRFYGPALQMFGPPDEDSPNSKQSMAWNIKRFSNDEL 244 Query: 242 RQRFIDQTVPQLELLGCTAPDPELKWNEERGHYDFGAIDWSEFYEVLKGNGPCNAERIAT 301 RQRF+D VPQ E LG T PDP+LKWNEERGHYD+G +DW+EF V+ G GPC+++R+ Sbjct: 245 RQRFVDMIVPQAEALGLTLPDPDLKWNEERGHYDYGPLDWNEFKAVIAGKGPCSSQRMQR 304 Query: 302 RRNAIDNGAWVREAAVAHARK 322 RR A D+GAWVREAA A+ARK Sbjct: 305 RRQAHDDGAWVREAAAAYARK 325 Lambda K H 0.318 0.131 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 338 Length adjustment: 28 Effective length of query: 302 Effective length of database: 310 Effective search space: 93620 Effective search space used: 93620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory