Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_058860019.1 AS188_RS15780 acetyl-CoA C-acyltransferase
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_001482365.1:WP_058860019.1 Length = 399 Score = 404 bits (1038), Expect = e-117 Identities = 217/402 (53%), Positives = 281/402 (69%), Gaps = 4/402 (0%) Query: 1 MREAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQA 60 M EAF+ G RTP+GRYGGALSSVR DDLAA+ ++ V + +D +D+VILG AN A Sbjct: 1 MTEAFLVGGARTPVGRYGGALSSVRPDDLAALVVKHA-VTDAGIDPHDVDEVILGNANGA 59 Query: 61 GEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESM 120 GE+NRNVARMA LLAG P +V G T+NRLC S L A+ A+ IKAG D+++AGGVESM Sbjct: 60 GEENRNVARMAWLLAGFPDTVPGITVNRLCASSLSAIIMASHMIKAGAADVVVAGGVESM 119 Query: 121 SRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFG-TDSMPETAENVAELLKISRE 179 SRAP+VM K A+AF++ E+FDT+IGWRF NP + T SMPETAE VA + I+RE Sbjct: 120 SRAPWVMEKPATAFAKPGEVFDTSIGWRFTNPEFKKHDKMTYSMPETAEEVAAVDGITRE 179 Query: 180 DQDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLK 239 D D+FA+ S ++ A +G A+EIVPV +K +KG T + DE RP TT++ L L+ Sbjct: 180 DADAFAVASHEKAIAAIDAGRFADEIVPVTVKGRKGAETVVDTDEGPRPGTTMDVLAKLR 239 Query: 240 APFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGP 299 V+TAGN+S +NDGA+A+++ SE+ A GLT RARIV A+AGV P +MGLGP Sbjct: 240 PVVTHGSVVTAGNSSSLNDGASAILVVSERAAEKYGLTARARIVDGASAGVAPEIMGLGP 299 Query: 300 VPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPL 359 VPAT++VLER G I D+ +ELNEAFA+Q+L +R LGL D VN +GGAIALGH L Sbjct: 300 VPATQKVLERTGWGIGDLGAVELNEAFASQSLACIRRLGL--DEGIVNNDGGAIALGHAL 357 Query: 360 GMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 G SG+RL + + R L TMC+GVGQG AM++E++ Sbjct: 358 GSSGSRLVVTLLGRMEREGAERGLATMCVGVGQGTAMLVEKI 399 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 399 Length adjustment: 31 Effective length of query: 370 Effective length of database: 368 Effective search space: 136160 Effective search space used: 136160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory