Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate WP_058857241.1 AS188_RS00800 acetyl-CoA C-acetyltransferase
Query= uniprot:D8ITH5 (401 letters) >NCBI__GCF_001482365.1:WP_058857241.1 Length = 396 Score = 242 bits (618), Expect = 1e-68 Identities = 154/399 (38%), Positives = 233/399 (58%), Gaps = 10/399 (2%) Query: 2 EALICDAIRTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAGE 61 + ++ RTP G+ G L + A +L A +R +ER GV +V+ +L G QAG Sbjct: 6 DVVVLSGARTPQGKILGQLASFTAAELGAHAVRHALER-AGVAPEQVDYVLMGHVLQAGA 64 Query: 62 DNRNVARMAGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMTR 121 +N AR A + AG+P+ VP TVN++C S L AV AAR I++GE ++++AGG ESMT Sbjct: 65 -GQNPARQAAVTAGIPLDVPAETVNKVCLSGLVAVTHAARMIRAGEAEVVVAGGQESMTS 123 Query: 122 APFV-MGKAESAFARSAAIFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQ 180 AP + +G + + D V+ + A + S+ E+ + I+RA+Q Sbjct: 124 APHLALGVRQGKSYGDLKLEDAVAKDGLVD--VAACVSMGSLTESGNG---ERAISRAEQ 178 Query: 181 DAFALRSQQRWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHPRPDTTLATLAKLKGV 240 D A +S +R A A G F EIAP+T+PQ+KGDPLVV TD+ RP+ T ++A+L+ Sbjct: 179 DEVAAQSHRRAARAAEEGVFREEIAPVTVPQRKGDPLVVDTDQGVRPEATAESMARLRPA 238 Query: 241 VRPDGTVTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAP 300 DGT+TAGN+S ++DGA AL+L++ + A + L+ A V + P+ Sbjct: 239 FAQDGTITAGNSSPLSDGAAALVLSTREYAQRHGLEWLAVVGAPGQVAGPDTSLHSQPSR 298 Query: 301 AVRKVLAQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGA 360 A+ +A+ G ++ +D IE+NEAFA+ + +RDL P + A+V +GGA+A+GHP+GA Sbjct: 299 AIEAAVAKAGWSVQDLDFIEINEAFASVLIQSLRDLDYPLERANV--HGGAVAVGHPIGA 356 Query: 361 SGARLVTTAINQLERSGGRYALCTMCIGVGQGIALVIER 399 SGARL A +L R G A ++C G GQG AL++ R Sbjct: 357 SGARLALHAAFELARRGTGRAAVSLCGGGGQGEALLLHR 395 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 396 Length adjustment: 31 Effective length of query: 370 Effective length of database: 365 Effective search space: 135050 Effective search space used: 135050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory