Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_058858514.1 AS188_RS08645 long-chain fatty acid--CoA ligase
Query= BRENDA::A7KUK6 (562 letters) >NCBI__GCF_001482365.1:WP_058858514.1 Length = 506 Score = 199 bits (507), Expect = 2e-55 Identities = 154/503 (30%), Positives = 240/503 (47%), Gaps = 46/503 (9%) Query: 49 SLRDASLDFGKGLKALYEWRKGDVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDE 108 S R ASL +G++A GD +AL PN PV +G L GG + P NP + E Sbjct: 37 SARVASLLTSRGVRA------GDRVALILPNVPHMPVAYYGVLRTGGVVVPLNPLLSPRE 90 Query: 109 LAFQLKNSHAKGLVTQASVLPVAREAAKKVGMPEDRIILIGDQRDPDAR-VKHFTSVRNI 167 L + +++ ++ +V AR AA ++G + + P+ R V V Sbjct: 91 LGYHFQDAEVSLVLVWETVAGAARAAAAELGRDVPVVEITAAGTLPELRRVPPLPEVAER 150 Query: 168 SGATRYRKQKITPAKDVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWNGG 227 +G +D A L+Y+SGTTG PKG +++H N+ +N R E+ S Sbjct: 151 AG------------EDPAVLLYTSGTTGRPKGAVLTHANLTSNAR----LSAELFSL--- 191 Query: 228 PDGKGDRVLAFLPFYHIYGLTCLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSYIV 287 GD + LPF+H++G T + AL G + ++ +FD + + + V Sbjct: 192 --APGDVMFGGLPFFHVFGQTVALNGALGAGATVTLLPRFDPARALEILVRDEVTVFAGV 249 Query: 288 PPVVLLLGKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTT 347 P + + L + + LR SG +PL E++E + + +GYGLSETSP Sbjct: 250 PSMYVALLRAAGGEPVRAPHLRAGVSGGSPLPVEVLERFEALFGAPVYEGYGLSETSPVV 309 Query: 348 HSQRWEDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHE 407 + ED GS+G ++ Q + + +D EV GE+GEL + G V GY Sbjct: 310 CFNQ-EDRGRRPGSIGTVVRGAQLRVL---DDAGA--EVPVGEIGELAVAGEYVMAGYWR 363 Query: 408 NPEATKGCLSEDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDA 467 NPEAT + +DGWF+TGD+ D G ++I DR K+++ G+ V P E+E L Sbjct: 364 NPEATAAAI-QDGWFRTGDLARVDEDGFYWIVDRKKDMVLRGGYNVYPREIEEVLYQYPG 422 Query: 468 IDDVAVIGIESETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIK---WLDSKVASHKRL 524 I + AV+G+ E G EV R E + AR+ + ++ ++A +K Sbjct: 423 IAEAAVVGVPDEAMGEEVAAVVAFRD-------VPEPERPARLDELDAFVRERLARYKHP 475 Query: 525 RGGVHFVDEIPKNPSGKILRRIL 547 R V+E+PK P+GKIL+R L Sbjct: 476 R-WYKVVEELPKGPTGKILKRSL 497 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 683 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 562 Length of database: 506 Length adjustment: 35 Effective length of query: 527 Effective length of database: 471 Effective search space: 248217 Effective search space used: 248217 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory