Align NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon; Phenylglyoxylate:NAD oxidoreductase; Phenylglyoxylate:acceptor oxidoreductase; EC 1.2.1.58 (characterized)
to candidate WP_058857692.1 AS188_RS03580 pyridine nucleotide-disulfide oxidoreductase
Query= SwissProt::Q8L3B0 (421 letters) >NCBI__GCF_001482365.1:WP_058857692.1 Length = 399 Score = 115 bits (288), Expect = 2e-30 Identities = 94/279 (33%), Positives = 133/279 (47%), Gaps = 13/279 (4%) Query: 11 LIAGSSHAALEAINAIRMHDAEGPITVVTRDAHLPYS-PTVLPYVVSGKSAPERIFLRD- 68 +I G+S A L A A R H G +TVV D PY P + ++G+ E + L Sbjct: 5 VIVGASLAGLAAARAARNHGYTGRLTVVGEDPQRPYDRPPLSKDFLAGRIGAEDLALETE 64 Query: 69 -DDFFARNKVAYRPKAALKALHADRNTAELADGSSVVYEKLLLATGASP-AIPPIPGIDT 126 DD A + R + A T L DG + E L++ATGASP ++PPI G+D Sbjct: 65 ADDLDAEWVLGVRAVS----FDAVTRTVVLDDGRLLHAEGLVVATGASPRSLPPIAGLDN 120 Query: 127 VSYHVLRTLDDALKLRGAIAESKQAVVLGAGLVGMHAAENLVKAGATVTIVEMSEQLTSG 186 V LRT+ DA +LR +A ++ VV+GAG +G A + G VT+VE S G Sbjct: 121 VV--TLRTVADAHRLRELLAPGRRLVVVGAGFIGAEVASTAHELGLEVTVVEKSPTPLCG 178 Query: 187 YFDKVAADMIEQAFRDAGGKIMTGSRVVRLEPTAAGA--KLTLENGTTLEADLLLVATGV 244 ++ AG +++ G+ + R E A GA + L G L AD+++V G Sbjct: 179 PLGAELGAVVAGLHERAGVELLCGTDIERFE-VAGGAVRAVHLAGGRQLPADVVVVGIGA 237 Query: 245 KPEMDYLNGSGVEHAQGILVDDRMQTTAENVWAAATAQA 283 P +L GSGVE G+L D +T V A A Sbjct: 238 APNTAWLEGSGVELGNGVLCDAVGRTGVPGVVAVGDCAA 276 Lambda K H 0.318 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 399 Length adjustment: 31 Effective length of query: 390 Effective length of database: 368 Effective search space: 143520 Effective search space used: 143520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory