Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate WP_058857809.1 AS188_RS04270 acetoin reductase
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >NCBI__GCF_001482365.1:WP_058857809.1 Length = 259 Score = 177 bits (449), Expect = 2e-49 Identities = 103/252 (40%), Positives = 145/252 (57%), Gaps = 5/252 (1%) Query: 8 KVAILTGAASGIGEAVARRYLDEGARCVLVDVKPA---DSFGDSLRATYGDRVLTVSADV 64 +VA++TGA GIG+A+A R +G LVD++ + G+ + AT G R V+ADV Sbjct: 6 RVALVTGAGRGIGKAIALRLAQDGFDVGLVDLRDELTREVLGE-IEAT-GRRACAVTADV 63 Query: 65 TRRDDIQRIVASTLERFGQIDILFNNAALFDMRPILEESWDVFDRLFAVNVKGMFFLMQA 124 + RD ++ V ER G++D++ NNA + ++PILE + D + + VN+ G+ + +QA Sbjct: 64 SDRDSVRAAVQEVAERLGRLDVMVNNAGIAQVQPILEVTPDEVETIERVNINGVLWGIQA 123 Query: 125 VAQKMVEQGCGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPHKINVNGI 184 A + +EQG GKIIN +S AG G A++ Y ATK AV TQ+AA LAPH I VN Sbjct: 124 AAARFLEQGTRGKIINAASIAGHEGFAVLGVYSATKFAVRGLTQAAAKELAPHGITVNAY 183 Query: 185 APGVVDTPMWNEVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAALFLASADAD 244 PGVV T MW E+D FA G + LGR P+D+ +LA DAD Sbjct: 184 CPGVVGTDMWVEIDERFAELTGAEKGATYEQYVGGIALGRAQTPEDVAAFVSYLAGPDAD 243 Query: 245 YITAQTLNVDGG 256 Y+T Q +DGG Sbjct: 244 YMTGQAPLIDGG 255 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 259 Length adjustment: 24 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory