Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate WP_058857809.1 AS188_RS04270 acetoin reductase
Query= CharProtDB::CH_091826 (259 letters) >NCBI__GCF_001482365.1:WP_058857809.1 Length = 259 Score = 109 bits (272), Expect = 7e-29 Identities = 78/255 (30%), Positives = 124/255 (48%), Gaps = 3/255 (1%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANRLADTINSRYGAGRAYGFKVDA 62 +VA+V G G+ +G + LAQ G+ V + DL + + I + RA D Sbjct: 6 RVALVTGAGRGIGKAIALRLAQDGFDVGLVDLRDELTREVLGEIEAT--GRRACAVTADV 63 Query: 63 TDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSRE 122 +D SV A + V E GR D++V +AG+A+ PI + + + +VN+ G + Sbjct: 64 SDRDSVRAAVQEVAERLGRLDVMVNNAGIAQVQPILEVTPDEVETIERVNINGVLWGIQA 123 Query: 123 FSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSL 182 + + G +G+II S +G G YSA KF GLTQ+ A +LA +GITV++ Sbjct: 124 AAARFLEQGTRGKIINAASIAGHEGFAVLGVYSATKFAVRGLTQAAAKELAPHGITVNAY 183 Query: 183 MLGNLLKSPMFQSLLPQYAEKLGITPEEVEPYYVDKVPLKRGCDYQDVLNVLLFYASDKA 242 G ++ + M+ + ++AE G YV + L R +DV + + A A Sbjct: 184 CPG-VVGTDMWVEIDERFAELTGAEKGATYEQYVGGIALGRAQTPEDVAAFVSYLAGPDA 242 Query: 243 AYCTGQSINVTGGQV 257 Y TGQ+ + GG V Sbjct: 243 DYMTGQAPLIDGGLV 257 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 259 Length adjustment: 24 Effective length of query: 235 Effective length of database: 235 Effective search space: 55225 Effective search space used: 55225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory