Align Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_058859466.1 AS188_RS14700 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q72L52 (376 letters) >NCBI__GCF_001482365.1:WP_058859466.1 Length = 378 Score = 346 bits (888), Expect = e-100 Identities = 194/363 (53%), Positives = 241/363 (66%), Gaps = 35/363 (9%) Query: 18 AVKDFNLETEDGEFVVFVGPSGCGKTTTLRMIAGLEEISEGNIYIGDRLVNDVPPKDRDI 77 +V + NLE DGEF+V VGPSGCGK+TTLRM+AGLEE+++G I+IGDR V DVP +DRDI Sbjct: 20 SVTELNLEVADGEFLVLVGPSGCGKSTTLRMLAGLEEVTDGQIFIGDRDVTDVPSRDRDI 79 Query: 78 AMVFQNYALYPHMNVYENMAFGLRLRRYPKDEIDRRVKEAARILKIEHLLNRKPRELSGG 137 AMVFQNYALYPHM+V ENM F L++ + P E RV+EAA+IL + L+RKP+ LSGG Sbjct: 80 AMVFQNYALYPHMSVAENMGFALKIAKVPAAERRARVEEAAKILDLTDYLDRKPKALSGG 139 Query: 138 QRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVEMRAEIAKLQRRLGVTTIYVTHDQVEA 197 QRQRVAMGRAIVR P+VFLMDEPLSNLDAKLRV+ R +IA L RRLGVTT+YVTHDQVEA Sbjct: 140 QRQRVAMGRAIVRSPQVFLMDEPLSNLDAKLRVQTRTQIASLTRRLGVTTVYVTHDQVEA 199 Query: 198 MTLGHRIVVMKDGEIQQVDTPLNLYDFPANRFVAGFIGSPSMNFVRAGVEVQGEKVYLVA 257 MT+G R+ V+KDG + QVDTP LYD PA FVAGFIGSP+MN R V G ++ V Sbjct: 200 MTMGDRVAVLKDGVLMQVDTPRALYDRPATEFVAGFIGSPAMNLFRVPVTEAGAQLGTV- 258 Query: 258 PGFRIRANAVLGSALKPYAGKEVWLGVRPEHLGLKGYTTIPEEENVLRGEVEVVEPLGAE 317 R+ + SAL+ G +V +G+RPE L G E L +VVE LGA+ Sbjct: 259 ---RVPLSPAQRSALR---GPQVTVGIRPEDLAPAG------EGTGLPIVADVVEELGAD 306 Query: 318 TEIH------------VAVNGTL----------LVAKVDGHAPVKPGDKVELLADTQRLH 355 ++ V V+ T V +V+G P + G V + D + +H Sbjct: 307 AFVYGHLAPVTAANTVVPVDATTGAADDPTTHEFVVRVEGRTPPQAGSTVWVAPDLEHVH 366 Query: 356 AFD 358 FD Sbjct: 367 LFD 369 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 378 Length adjustment: 30 Effective length of query: 346 Effective length of database: 348 Effective search space: 120408 Effective search space used: 120408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory