Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_059175370.1 TAGGR_RS00205 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_001514535.1:WP_059175370.1 Length = 247 Score = 152 bits (385), Expect = 5e-42 Identities = 87/250 (34%), Positives = 144/250 (57%), Gaps = 14/250 (5%) Query: 1 MGILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSV 60 M +LE KN+ K++GGL+ L++VNL V + + +IGPNGAGK+TL+N + G + Sbjct: 1 MIMLETKNLAKKYGGLEVLNNVNLKVYKGEILGLIGPNGAGKTTLMNLICRLTDITRGEI 60 Query: 61 MFDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVS 120 + G+ + + PYEI++MGI+R FQ + F L+VLEN+M+ F R A Sbjct: 61 YYKGELINNKKPYEISKMGIARTFQVVKPFKGLTVLENVMVGAFYGRKNA---------K 111 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 + + + A L+ + + +++ + + +++LE+ L+ +P LL+LDE AG+ Sbjct: 112 NRAEAKDIAMDALKIVGLLNEKDREPSILPIAQRKKLELARALAMDPELLILDEVMAGLN 171 Query: 181 RADTNNTIDLLKQI--KSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKG 238 + + D++K+I ER ITI IEH M V+ ++DR+ VL G + E P + Sbjct: 172 PKELD---DIMKEILLLKERGITIIAIEHVMKVIMGISDRVVVLHLGELICEGKPHEVCN 228 Query: 239 NPKVREAYLG 248 +P+V EAYLG Sbjct: 229 HPQVIEAYLG 238 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 247 Length adjustment: 24 Effective length of query: 227 Effective length of database: 223 Effective search space: 50621 Effective search space used: 50621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory