GapMind for catabolism of small carbon sources

 

Protein WP_067910711.1 in Novosphingobium fuchskuhlense FNE08-7

Annotation: NCBI__GCF_001519075.1:WP_067910711.1

Length: 330 amino acids

Source: GCF_001519075.1 in NCBI

Candidate for 128 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 41% 88% 231.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 98% 230.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 43% 72% 225.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 42% 83% 220.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 73% 214.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 73% 214.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 86% 213.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 86% 213.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 42% 83% 206.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 84% 204.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 41% 85% 204.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 40% 72% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 70% 189.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 40% 98% 168.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized) 41% 99% 157.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 40% 92% 157.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 39% 92% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 98% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 39% 98% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 69% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 46% 60% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 67% 208.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 67% 204.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 63% 204.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 65% 202.6 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 41% 67% 202.6 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 67% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 44% 64% 197.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 75% 193 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 41% 63% 188.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 41% 65% 188.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 75% 184.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 43% 65% 181.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 69% 176 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 39% 95% 172.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 38% 60% 170.6 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 40% 92% 168.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 40% 92% 168.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 31% 96% 167.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 31% 96% 167.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 31% 96% 167.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 31% 96% 167.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 38% 74% 163.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 39% 54% 162.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 38% 94% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 37% 92% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 82% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 38% 94% 159.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 39% 92% 157.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 96% 155.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 88% 155.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 37% 96% 154.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 94% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 90% 153.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 90% 153.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 37% 75% 153.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 39% 88% 152.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 39% 88% 152.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 34% 98% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 34% 98% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 37% 90% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 35% 97% 147.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 34% 97% 146.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-alanine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-serine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-threonine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 30% 98% 137.1 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 31% 98% 136.3 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 36% 85% 134.4 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 35% 94% 129.4 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 35% 82% 126.7 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 71% 125.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-serine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 95% 120.6 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-tyrosine catabolism Ac3H11_1693 lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 95% 120.6 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 31% 67% 120.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-isoleucine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-leucine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 88% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-valine catabolism livF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 33% 92% 119 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 93% 118.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 93% 118.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 93% 118.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 31% 93% 118.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 88% 115.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 33% 86% 114.8 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 33% 84% 112.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 96% 110.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 96% 110.5 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 32% 95% 105.9 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 31% 84% 104 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 82% 98.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 82% 98.2 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 80% 94 CysA aka B2422, component of Sulfate/thiosulfate porter 61% 301.6

Sequence Analysis Tools

View WP_067910711.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIQLRGITKRFGDYPALHGIDLDVAPGEFIALLGPSGSGKTTLLRIIAGLEFQDGGSVLL
GGEDVSSLPVARRHVGFVFQHYALFRHMTVADNVAFGLSVRRGKDRLPKVARLARAEELL
RLVQLEGLGSRYPGQLSGGQRQRVALARALAIEPRLLLLDEPFGALDAKVRKDLRRWLRD
LHKQMGLTSIFVTHDQEEALELADRVVVMNQGRIEQIGAPDAVYMNPETPFVSHFVGETN
RLPTTSGEIHFRPHEITLAPDGAEALLVDNVFRKGAVWRAEGLLAGSGQFVELDLPSSGE
APRLGETIRFNPHRARMFTADGAQTQGESR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory