GapMind for catabolism of small carbon sources

 

Protein WP_067910816.1 in Novosphingobium fuchskuhlense FNE08-7

Annotation: NCBI__GCF_001519075.1:WP_067910816.1

Length: 224 amino acids

Source: GCF_001519075.1 in NCBI

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 144.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 144.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-lysine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 144.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 38% 54% 129.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 38% 83% 129.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 86% 128.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 32% 60% 122.5 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 34% 58% 121.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 33% 59% 119 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 33% 59% 119 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 35% 56% 115.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 32% 57% 115.2 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 33% 64% 109.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 33% 79% 104.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-proline catabolism HSERO_RS00900 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 31% 86% 87.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 30% 57% 86.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 84% 81.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-leucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 84% 81.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-phenylalanine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 84% 81.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-serine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 84% 81.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
L-tyrosine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 30% 84% 81.3 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 31% 83% 80.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 47% 204.5

Sequence Analysis Tools

View WP_067910816.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSEPFVRLANLRRSFSQGGETIEVLRGIDLAIRPGEIVALLGPSGSGKSTMLQAVGLLEG
GFTGKIEIAGIEASALSADARTALRRDHLGFVYQFHHLLPDFNATENVVLPQLIAGKGAG
EARARAEELLTALGLGHRLTHRPSQLSGGEQQRVAVARALANRPGLVLADEPTGNLDEAT
ADKVLEQFLKLVRGEGSSALVATHNERLALRMDRVVRLHEGLLA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory