Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_067913134.1 AQZ52_RS15760 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_001519075.1:WP_067913134.1 Length = 320 Score = 165 bits (418), Expect = 1e-45 Identities = 114/283 (40%), Positives = 158/283 (55%), Gaps = 16/283 (5%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPS 105 +L E R PR LAL +GA L AG +QG +RNPLA P + GV +A+ +V AL L Sbjct: 40 ILAELRAPRTALALVIGAGLGGAGAAMQGYLRNPLADPGLFGVAPSAAFGAVLALALGLG 99 Query: 106 LPVMVLPLLAFAGGMAGLILLKMLA----KTHQPMKLALTGVALSACWASLTDYLMLSRP 161 +LPL A AG A + L ++A ++ AL G+ L++ +LT ++ P Sbjct: 100 T---LLPLAALAGAAAAMAALGLIAGNAGSSNSTSLFALAGLMLASLSGALTSLVISLAP 156 Query: 162 QD--VNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGV 219 ++ + WL GSL R W V +A P L L L L LD L LG+ A +LGV Sbjct: 157 NPFAMSEIVTWLMGSLEARAWHDVLLAAPPTALGLVLLLRAGPALDALTLGEETARSLGV 216 Query: 220 SVPHTRFWALLLAVAMT-STGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGAL 278 P W ++L + GVAA G I FIGLVVPH++R T R L+ SAL GAL Sbjct: 217 E-PARLLWCMVLGTGLVVGAGVAAAGIIGFIGLVVPHLLRPFTDQRPSSLILPSALGGAL 275 Query: 279 LLVVADLLARIIHPPL---ELPVGVLTAIIGAPWFVWLLVRMR 318 LL+VAD L R++ PL EL +G+ +++GAP+F+ LL+R+R Sbjct: 276 LLLVADCLCRLL--PLAGGELRIGIALSLLGAPFFLALLLRLR 316 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 320 Length adjustment: 28 Effective length of query: 290 Effective length of database: 292 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory