Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_067911092.1 AQZ52_RS12330 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001519075.1:WP_067911092.1 Length = 260 Score = 145 bits (366), Expect = 8e-40 Identities = 94/263 (35%), Positives = 149/263 (56%), Gaps = 12/263 (4%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKA 60 M+YE I VET G V + LNRP+ LNA + E+G AL +D + A A+V+TG +A Sbjct: 1 MSYETIRVETVGLVRSIVLNRPERLNACPPNMAVEIGDAL--YDLEGA-RAVVITGEGRA 57 Query: 61 FAAGADI---GMMSTYTYMDVYKGDYITRNWETVRS----IRKPIIAAVAGFALGGGCEL 113 F +GAD+ G S YK +T ++ + + + PI+ AV G A G GC + Sbjct: 58 FCSGADLAVSGKRSVAGGAGSYKA--LTESYNPMIAKLSRLSVPIVTAVNGPAAGVGCSI 115 Query: 114 AMMCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAER 173 A+M D + AA +A F Q + +G++P G + LPR + K++A+ + + + A +AE Sbjct: 116 ALMGDFVLAAKSAYFLQAFVNIGLVPDGGASWVLPRLIGKSRALQMMMLGERVGAEKAEE 175 Query: 174 AGLVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHS 233 G++ + + A+L DEA+A A +A P+ A+ +++++V RA ET L + E Sbjct: 176 WGMIYKAVDDAALADEAMALAERLANGPTVALGVMRQNVARALETDLPAALLIEAEGQWK 235 Query: 234 LFATEDQKEGMAAFVEKRKPVFK 256 + D KEG++AF+EKRK FK Sbjct: 236 AGDSSDAKEGISAFLEKRKADFK 258 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory