Align acetyl-CoA C-acyltransferase (EC 2.3.1.16) (characterized)
to candidate WP_067906010.1 AQZ52_RS00475 acetyl-CoA C-acyltransferase
Query= BRENDA::Q8VCH0 (424 letters) >NCBI__GCF_001519075.1:WP_067906010.1 Length = 391 Score = 278 bits (710), Expect = 3e-79 Identities = 171/390 (43%), Positives = 237/390 (60%), Gaps = 9/390 (2%) Query: 37 DVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA 96 D V+V RTPIGRA +G F T L + L A + ++ ++ D+ G+ LQ GA Sbjct: 3 DAVIVAAARTPIGRAYKGAFNTTAGATLGALSLEAAVARAGIEGGEVDDVLWGSALQQGA 62 Query: 97 GA-IMARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTL 155 A +AR +G+P TV +++RQCSSGL +A A I D+ A G ES++L Sbjct: 63 QAGNIARQVALRAGLPVTVSGMSMDRQCSSGLMTIATAAKQIIVDRMDVVAAGGQESISL 122 Query: 156 SQRGNHGNISSRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAASAQS 215 Q + R L +PM T+E V +R+ +SR+ D +AL SQQ+ A+AQ+ Sbjct: 123 VQTKDMRVAPDRSLVAMHGA-VYMPMLQTAETVGKRYNISREACDEYALQSQQRTAAAQA 181 Query: 216 RGCFHAEIVPVTTTVLNDKGDKKTITVSQ-----DEGVRPSTTMQGLAKLKPAFKDGGST 270 G F AEIVP T+++ + IT+ + DEG RPSTT++ L LKP +GG Sbjct: 182 AGKFDAEIVPTTSSMGVQNKETGEITMQEVHLTKDEGNRPSTTLENLQALKPVI-EGGIV 240 Query: 271 TAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQ 330 TAGN+SQ+SDG+AAV+L + A + GL LG A G PD MGIGP +A+PA L+ Sbjct: 241 TAGNASQLSDGSAAVVLMEAAVAAKKGLTPLGRYVGMAAAGTEPDEMGIGPVFAVPALLK 300 Query: 331 KAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTL 390 + GL ++DI ++E+NEAFA Q +YC +KLGIP E +N GGAI++GHP G TGAR V+ Sbjct: 301 RFGLKMDDIGLWELNEAFAVQVLYCRDKLGIPNELLNVNGGAISIGHPYGMTGARGVMHA 360 Query: 391 LNELKRRGRRAYGVVSMCIGTGMGAAAVFE 420 L E KRRG + + VV+MC+G GMGAA +FE Sbjct: 361 LIEGKRRGAK-HVVVTMCVGGGMGAAGLFE 389 Lambda K H 0.317 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 391 Length adjustment: 31 Effective length of query: 393 Effective length of database: 360 Effective search space: 141480 Effective search space used: 141480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory