Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_067906016.1 AQZ52_RS00510 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001519075.1:WP_067906016.1 Length = 260 Score = 297 bits (760), Expect = 2e-85 Identities = 161/261 (61%), Positives = 195/261 (74%), Gaps = 4/261 (1%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EK 59 M+YE ILVE RG V L+TLNRPK+LNALN +++EL A ++AD + V+TGS EK Sbjct: 1 MSYETILVEQRGAVTLITLNRPKSLNALNSQVLEELIVAFGAYEADPSQRCAVLTGSGEK 60 Query: 60 AFAAGADIGMMSTYTYMDVYKGDYITRNWET--VRSIRKPIIAAVAGFALGGGCELAMMC 117 AFAAGADI M+ D Y GD+ +R W + V++ RKP IAAV GFALGGGCELAMM Sbjct: 61 AFAAGADIKEMADKAATDFYTGDFFSR-WTSHLVKTTRKPWIAAVNGFALGGGCELAMMA 119 Query: 118 DIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLV 177 D I A++ AKFGQPEIKLG+ PG GG+QRL RAV KAKAMD+CLT+R MDA EAER+GLV Sbjct: 120 DFIIASENAKFGQPEIKLGVAPGMGGSQRLTRAVGKAKAMDMCLTSRMMDAVEAERSGLV 179 Query: 178 SRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFAT 237 SRV+P ASL+DEA+AAA IA P A + KE VN A+E TL +G+ FERR+F L AT Sbjct: 180 SRVVPLASLIDEAVAAAEAIAAMPPVATIANKEMVNAAFEMTLDQGLLFERRVFQILTAT 239 Query: 238 EDQKEGMAAFVEKRKPVFKHR 258 ED+ EGMAAF+EKR V+K R Sbjct: 240 EDKAEGMAAFIEKRPGVWKGR 260 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory