Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_067911841.1 AQZ52_RS13795 crotonobetainyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_001519075.1:WP_067911841.1 Length = 259 Score = 155 bits (391), Expect = 1e-42 Identities = 100/262 (38%), Positives = 153/262 (58%), Gaps = 10/262 (3%) Query: 1 MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA 60 MS + + +Q +L++TL+RP A NA++ A ++L + D ++ V +ITG RFF+ Sbjct: 1 MSAVKLDQQGGILIITLDRPKA-NAIDVATSLELHAAFKTLNDDPALRVGIITGTGRFFS 59 Query: 61 AGADLNEMAEKDLAATLNDTRPQLWARLQAF---NKPLIAAVNGYALGAGCELALLCDVV 117 AG DL A D A D P +A L + KP+IAAVNG A+G G ELAL D++ Sbjct: 60 AGWDLG--AANDGEAVDADHGPGGFAGLTEYFSLTKPVIAAVNGLAVGGGFELALAADLI 117 Query: 118 VAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDV 177 V E A+F LPE LG++P +GG RL +++ LA +M+L+G + A +A LVS V Sbjct: 118 VVSETAKFWLPEAQLGMLPDSGGLLRLPKAIPARLAREMILTGRRLDAAEALSLHLVSRV 177 Query: 178 FPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQ----LFTLLAA 233 D + AL+LA+ +A+ +PLAL AA+ LR ++ + ++AG R + + Sbjct: 178 TEPDALMACALELATTVAQSAPLALTAARDILRATEGMEVEAGYRLMRSGAIPAYQAMLQ 237 Query: 234 TEDRHEGISAFLQKRTPDFKGR 255 ++D EG AF + R P++KGR Sbjct: 238 SDDALEGPRAFGEGRAPEWKGR 259 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory