Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate WP_067908804.1 AQZ52_RS09260 acetyl-CoA C-acyltransferase
Query= uniprot:D8ITH5 (401 letters) >NCBI__GCF_001519075.1:WP_067908804.1 Length = 398 Score = 258 bits (658), Expect = 3e-73 Identities = 157/400 (39%), Positives = 230/400 (57%), Gaps = 15/400 (3%) Query: 4 LICDAIRTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAGEDN 63 +I RTP G G+L V A L A +++ +ER G+ +VE I GC AG Sbjct: 11 VILSFARTPMGAMQGSLADVSATQLGATAVKAAVER-AGIAGEKVERIYMGCVLPAGL-G 68 Query: 64 RNVARMAGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMTRAP 123 + AR A + AGLP +V +TV ++CGS + A+ M A A+ SG + +++AGG+ESMT AP Sbjct: 69 QAPARQAAIYAGLPASVEATTVGKVCGSGMQAMIMGAEALASGSIDMVVAGGMESMTNAP 128 Query: 124 FVMGKAESAFARSAAIFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQDAF 183 +++ K S AR DT F++ L A +M A++ A +Q+ R QDA+ Sbjct: 129 YLLKKHRSG-ARIG--HDTAYDHMFLDGLEDAYEPGRAMGTFAQDTANAYQLTREQQDAY 185 Query: 184 ALRSQQRWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHP---RPDTTLATLAKLKGV 240 A+ S +R A A G FA EI P+T+ + G+ +V TDE P +PD A LK Sbjct: 186 AIESLRRAQTAIAEGAFAAEITPVTVASRAGET-IVDTDEAPGKGKPDKIPA----LKPA 240 Query: 241 VRPDGTVTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAP 300 DGT+TA +S ++DGA A++L A LKP ARV+ +A AP+ P Sbjct: 241 FAKDGTITAATSSSISDGAAAMVLTRESVAAADGLKPVARVVALAAHAQAPKDFTTAPVG 300 Query: 301 AVRKVLAQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGA 360 A+ K+L + G ++A +D+ E+NEAFA + M DLG+P + +N +GGA A+GHP+GA Sbjct: 301 AITKLLGKAGWSIADVDLFEVNEAFACVAMFAMHDLGIPHE--KINVHGGATALGHPIGA 358 Query: 361 SGARLVTTAINQLERSGGRYALCTMCIGVGQGIALVIERV 400 SGAR+VTT I L+R G + + ++CIG G+ A+ IE V Sbjct: 359 SGARIVTTLIGALQRHGKKRGVASLCIGGGEATAVAIELV 398 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 398 Length adjustment: 31 Effective length of query: 370 Effective length of database: 367 Effective search space: 135790 Effective search space used: 135790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory