Align D-serine/D-alanine/glycine transporter (characterized)
to candidate WP_084271517.1 AYX06_RS08205 amino acid permease
Query= SwissProt::P0AAE0 (470 letters) >NCBI__GCF_001580365.1:WP_084271517.1 Length = 471 Score = 259 bits (663), Expect = 1e-73 Identities = 147/441 (33%), Positives = 243/441 (55%), Gaps = 5/441 (1%) Query: 22 NLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSN 81 +L RH+ ++A+G AIGTGLF+G+G I AGP+++ +++ +L VMRA+GE+ ++ Sbjct: 30 HLKARHLVMMALGSAIGTGLFIGTGAAIRTAGPAVLLSFLVACVLLVLVMRALGEMAAAD 89 Query: 82 LEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWVASLA 141 +FS +A +G G GW +W VV A+ A +P WV +L Sbjct: 90 PSPGAFSTYAEKAMGRTVGRTLGWLWWAQIVVVVAAEATAAAQLLTELWPVAEQWVLALL 149 Query: 142 VIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASFAHLW 201 +V+ +NL V+ GE EFWFA++K++A+++ + VGL ++ P+ +L Sbjct: 150 FMVVFTAVNLVKVRTLGETEFWFALMKVLAVLAFLGVGLAVLLGLTDVPS---PGLGNLT 206 Query: 202 NDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYV 261 GG+ P GL+G A + +FAF G ELV AAET+DP+ ++ RA+ +I +RI++FYV Sbjct: 207 AHGGFLPNGLTGVAAALLVVIFAFGGTELVTIAAAETEDPQHNVARAVRTILVRILVFYV 266 Query: 262 FALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVINFVVLTSAASSANSGVFSTSRM 321 A+ V++ V PW SPFV + G+P A V+ +++ + S+ N+ V+ +SRM Sbjct: 267 GAVTVMVLVLPWDDEQLSVSPFVAVLETAGVPGADVVMAVIIILALLSALNANVYGSSRM 326 Query: 322 LFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVIGAFTMITTVSAI 381 L+ LA+ G AP+AFA +S R VP + S G VV+ Y+ P + M+ TV A Sbjct: 327 LYSLARRGSAPRAFADVSARGVPRTAVLVSVAFGFGAVVLNYLWPETV-LLWMLNTVGAT 385 Query: 382 LFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCWVCMAFFVFVVVLLTLEDDTRQ 441 + VW + L S +V R++ + +M + W+ +A +++L L+D R Sbjct: 386 C-LVVWGLALVSQIVLRRRADRDGTELPLRMWAFPWLSWLALAILAGILLLGLLDDAVRG 444 Query: 442 ALLVTPLWFIALGLGWLFIGK 462 LL+T + + L +G+ Sbjct: 445 QLLLTAGLVLLIALASKLLGR 465 Lambda K H 0.329 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 471 Length adjustment: 33 Effective length of query: 437 Effective length of database: 438 Effective search space: 191406 Effective search space used: 191406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory