Align D-serine/D-alanine/glycine transporter (characterized)
to candidate WP_084271790.1 AYX06_RS16200 amino acid permease
Query= SwissProt::P0AAE0 (470 letters) >NCBI__GCF_001580365.1:WP_084271790.1 Length = 463 Score = 252 bits (644), Expect = 2e-71 Identities = 140/382 (36%), Positives = 224/382 (58%), Gaps = 20/382 (5%) Query: 30 LIAIGGAIGTGLFMGSGKTISLAGPS-IIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFS 88 +IA+GGAIGTGLF+ SG TI+ AGP + Y++IGFM+F +M+++GE+ +F Sbjct: 1 MIALGGAIGTGLFVASGNTIATAGPGGALLAYVVIGFMVFLLMQSLGEMATYLPVSGAFE 60 Query: 89 DFASDLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPDLSDWVASLAVIVLLLT 148 ++++ + P G+ GW YW+ W +T A++VA ++W PD+ W+ S A +++L Sbjct: 61 EYSTRFVSPSFGFAIGWNYWYNWAITVAAELVAAALIMRYWLPDVPSWIWSGAFLLILFL 120 Query: 149 LNLATVKMFGEMEFWFAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASFAHLWNDG-GWF 207 LN + + +GE EFWF+++K+V +V +V+G++M+ G E+ W G F Sbjct: 121 LNALSTRAYGESEFWFSLVKVVTVVIFLVLGILMIV----GILGGESPGFENWTTGEAPF 176 Query: 208 PKGLSGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYVFALIVI 267 G G A F +A F+F G ELVG A E +DPEK++P+AI ++ +RI++FYV A+ VI Sbjct: 177 VGGGLGILAIFMVAGFSFQGTELVGVAAGEAEDPEKNVPKAIRTVFVRILLFYVGAITVI 236 Query: 268 MSVTPWSSVVPEK----------SPFVELFVLVGLPAAASVINFVVLTSAASSANSGVFS 317 + P +S P SPF +F G+ AAASV+N V+LT+ S+ NSG+++ Sbjct: 237 GFLIPHTS--PNLLTSDVEDISISPFTLVFENAGVLAAASVMNAVILTAILSAGNSGLYA 294 Query: 318 TSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVVMLYVNPSVIGAFTMITT 377 ++RML+ LA G AP+ AK+++R VP L + L+GG L A+ + + Sbjct: 295 STRMLWALADGGKAPRFLAKVNRRGVPMNALLVT--TLVGGASFLTTFIGDGDAYVWLVS 352 Query: 378 VSAILFMFVWTIILCSYLVYRK 399 S + VW I S+ +R+ Sbjct: 353 ASGLAGFIVWMGIAWSHYRFRR 374 Lambda K H 0.329 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 44 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 463 Length adjustment: 33 Effective length of query: 437 Effective length of database: 430 Effective search space: 187910 Effective search space used: 187910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory