Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_062735693.1 AYX06_RS10315 SDR family oxidoreductase
Query= reanno::ANA3:7024897 (256 letters) >NCBI__GCF_001580365.1:WP_062735693.1 Length = 252 Score = 117 bits (292), Expect = 3e-31 Identities = 77/253 (30%), Positives = 126/253 (49%), Gaps = 20/253 (7%) Query: 13 KTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYHCDL 72 +T ++G A GIGA L G VA VD+ + + +V + T + Y D+ Sbjct: 6 RTAVVTGAARGIGAALAQRLAADGMAVAAVDLSADACSDVVEAI--TAAGGTARAYAADV 63 Query: 73 VDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFAVQA 132 D A++ ++ V +LGP +VL+NNA + + + ++ + WD +N +LR +F +A Sbjct: 64 ADEASVAGLVEAVAAELGPPTVLVNNAGVLRDNLLFRMSADDWDTVMNVHLRGHFLMSRA 123 Query: 133 VRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRINTLT 192 V+ M G G ++N+ S S + G A Y A+KAG G T+ LA +LGK + +N + Sbjct: 124 VQAHMTEQGWGRIVNISSTSALGNR-GQANYAAAKAGIQGFTKTLAIELGKFGVTVNAIA 182 Query: 193 PGWVMTKRQLTHWVDKDTAKH--IENNQCIKEYVM---------PEDIAAMALFLAADDS 241 PG + T + + TA+ + Q +++ PEDIAA A F A +D+ Sbjct: 183 PGLIETA------MTRATAERMGVPYEQFVEKAAQQIPVARTGTPEDIAAAASFFAREDA 236 Query: 242 KLCTAQNFIVDGG 254 + Q V GG Sbjct: 237 SFVSGQVLYVAGG 249 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 252 Length adjustment: 24 Effective length of query: 232 Effective length of database: 228 Effective search space: 52896 Effective search space used: 52896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory