Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_062735021.1 AYX06_RS06170 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_001580365.1:WP_062735021.1 Length = 269 Score = 244 bits (622), Expect = 2e-69 Identities = 129/246 (52%), Positives = 167/246 (67%), Gaps = 13/246 (5%) Query: 6 VQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNE 65 ++ LHK YG EVLKG+SL AG V+ +IG SGSGKST LRC+NLLE+P G+I + Sbjct: 23 IEGLHKSYGPLEVLKGISLSVGAGQVVCLIGPSGSGKSTLLRCVNLLEKPQQGRITI--- 79 Query: 66 ELKLVANKDGALKAADPK-QLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKA 124 G DP+ + RMR + MVFQ FNL+ H++ +EN A V VL KA Sbjct: 80 ---------GDFDVTDPEADVDRMRRHVGMVFQQFNLFPHLSVLENCTVAQVKVLKRDKA 130 Query: 125 EAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPEL 184 EA A L +VG+S + D++P +SGG+QQRVAIARAL+M+P +MLFDEPTSALDPE Sbjct: 131 EAERIARANLDRVGLSEKADSHPDQLSGGQQQRVAIARALSMDPSLMLFDEPTSALDPET 190 Query: 185 VGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSER 244 VGDVL +M+ LA EG TM+VVTHEM FAR+V++++VF+ GVV E G +V+ P+ R Sbjct: 191 VGDVLSIMRDLAAEGMTMLVVTHEMEFARDVADKVVFMDGGVVVEEGPAAQVIGAPKEPR 250 Query: 245 LQQFLS 250 Q FLS Sbjct: 251 TQSFLS 256 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 269 Length adjustment: 25 Effective length of query: 229 Effective length of database: 244 Effective search space: 55876 Effective search space used: 55876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory