Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_047803717.1 AYX06_RS05075 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_001580365.1:WP_047803717.1 Length = 228 Score = 206 bits (523), Expect = 4e-58 Identities = 103/217 (47%), Positives = 148/217 (68%), Gaps = 5/217 (2%) Query: 12 LLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLFC 71 +L AFWV ++LT ++AIG+ + G ++ MR+SP+ LR L T Y+N RNTPLT++++F Sbjct: 17 VLAAFWVNLRLTFWAAIGSAVLGGLIALMRISPIASLRLLGTGYVNLFRNTPLTIILVFL 76 Query: 72 SFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAA 131 G++ LG+ L+G + F F AV+G LY + FV E++RSG+NTV GQAEAA Sbjct: 77 VLGVWSQLGINLSGDFNQNF-----FNWAVIGLSLYHAAFVCEAIRSGVNTVPVGQAEAA 131 Query: 132 RSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLMKATIENH 191 R++GL F R IIFPQA+R A+ PLGNTLIALTKNTT+A+ V E S LMK IE Sbjct: 132 RAIGLSFLPAARLIIFPQALRGAVTPLGNTLIALTKNTTVAAAASVTEISSLMKTMIEFR 191 Query: 192 ANMLFVVFAIFAVGFMILTLPMGLGLGKLSERLAVKK 228 +++ +F + A+GF+++ +P+GL S +LAVK+ Sbjct: 192 PDVIIAIFLVVALGFVLIVVPVGLLTTWASRKLAVKR 228 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 228 Length adjustment: 23 Effective length of query: 205 Effective length of database: 205 Effective search space: 42025 Effective search space used: 42025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory