Align BadH (characterized)
to candidate WP_062735693.1 AYX06_RS10315 SDR family oxidoreductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_001580365.1:WP_062735693.1 Length = 252 Score = 181 bits (460), Expect = 1e-50 Identities = 101/245 (41%), Positives = 141/245 (57%), Gaps = 2/245 (0%) Query: 7 KTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCDIAD 66 +TAV+TG GIG A +R A +G +A DL+ DA V AI AGGTA A D+AD Sbjct: 6 RTAVVTGAARGIGAALAQRLAADGMAVAAVDLSADACSDVVEAITAAGGTARAYAADVAD 65 Query: 67 RTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAVL 126 SV + LGP +LVNNAG + +W+ ++ ++L G M AV Sbjct: 66 EASVAGLVEAVAAELGPPTVLVNNAGVLRDNLLFRMSADDWDTVMNVHLRGHFLMSRAVQ 125 Query: 127 PGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCPG 186 M E+ GRIVNI+S +A +G+ G+A YAA K G+ F+KTLA E + G+TVN + PG Sbjct: 126 AHMTEQGWGRIVNISSTSA-LGNRGQANYAAAKAGIQGFTKTLAIELGKFGVTVNAIAPG 184 Query: 187 PTDTALLADVTSGAANP-EKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQVL 245 +TA+ P E+ +E + IP+ R G P+D+A A +FF +DA F++GQVL Sbjct: 185 LIETAMTRATAERMGVPYEQFVEKAAQQIPVARTGTPEDIAAAASFFAREDASFVSGQVL 244 Query: 246 SVSGG 250 V+GG Sbjct: 245 YVAGG 249 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory