Align acetyl-CoA:acetoacetate CoA transferase, A subunit (EC 2.8.3.8) (characterized)
to candidate WP_062734961.1 AYX06_RS05780 3-oxoacid CoA-transferase subunit A
Query= reanno::psRCH2:GFF1045 (231 letters) >NCBI__GCF_001580365.1:WP_062734961.1 Length = 230 Score = 202 bits (515), Expect = 3e-57 Identities = 105/224 (46%), Positives = 146/224 (65%), Gaps = 3/224 (1%) Query: 1 MNKIYPSAAHALEGLVEDGMTIAVGGFGLCGIPEQLIAALRDSGKKDLTAISNNAGVDGF 60 M I S A A+ G + DG T+ +GGFG+ G P +LI AL D G DLT ++NNAG Sbjct: 1 MLHIAESCAQAVAG-IHDGATVMIGGFGVAGQPVELIDALIDHGATDLTVVNNNAGNGDV 59 Query: 61 GLGLLLETRQISKMVSSYVGENKE--FERQYLAGELALEFTPQGTLAEKLRAGGAGIPAF 118 GL L+ ++ K++ S+ ++ F+ +Y AG++ LE PQG LAE++RA GAGI AF Sbjct: 60 GLARLIGLGRVRKIICSFPRQSDSWHFDEKYRAGQIELEVVPQGNLAERIRAAGAGIGAF 119 Query: 119 YTKTGYGTLVAEGKETRQFNGEWYVMEESLTADLALVKAWKADKAGNLLFRKTARNFNPL 178 +T TGYGT +AEGKE R+ +G YV+E + AD +L KA AD+AGNL++RKTARNF P+ Sbjct: 120 FTPTGYGTPLAEGKEVREIDGRHYVLEHPIRADFSLTKAHVADRAGNLVYRKTARNFGPV 179 Query: 179 AAMAGEVCVVEVEEIVETGELDPDQIHLPGIYVHRIVHNPNPEK 222 A A +V+V E+V G LDP+ + PGIYV +V +P + Sbjct: 180 MAAAATTSIVQVTEVVARGALDPEVVVTPGIYVDTVVRIADPAR 223 Lambda K H 0.316 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 230 Length adjustment: 23 Effective length of query: 208 Effective length of database: 207 Effective search space: 43056 Effective search space used: 43056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory