GapMind for catabolism of small carbon sources

 

Protein WP_061531811.1 in Collimonas arenae Ter10

Annotation: NCBI__GCF_001584165.1:WP_061531811.1

Length: 218 amino acids

Source: GCF_001584165.1 in NCBI

Candidate for 14 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2554 med ABC transporter for L-Histidine, permease component 1 (characterized) 43% 97% 172.9 L-cystine transport system permease protein YecS 43% 179.1
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 37% 97% 140.2 L-cystine transport system permease protein YecS 43% 179.1
L-arginine catabolism artQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 33% 97% 125.9 L-cystine transport system permease protein YecS 43% 179.1
L-histidine catabolism hisQ lo Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 33% 97% 125.9 L-cystine transport system permease protein YecS 43% 179.1
L-histidine catabolism BPHYT_RS24010 lo Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale) 33% 88% 124.4 L-cystine transport system permease protein YecS 43% 179.1
L-lysine catabolism hisM lo ABC transporter for L-Lysine, permease component 2 (characterized) 33% 93% 124 L-cystine transport system permease protein YecS 43% 179.1
L-arginine catabolism artM lo AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized) 34% 93% 122.9 L-cystine transport system permease protein YecS 43% 179.1
L-histidine catabolism BPHYT_RS24005 lo Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale) 31% 98% 122.5 L-cystine transport system permease protein YecS 43% 179.1
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 34% 55% 120.9 L-cystine transport system permease protein YecS 43% 179.1
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 34% 55% 120.9 L-cystine transport system permease protein YecS 43% 179.1
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 30% 95% 120.2 L-cystine transport system permease protein YecS 43% 179.1
L-citrulline catabolism AO353_03045 lo ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized) 32% 93% 118.2 L-cystine transport system permease protein YecS 43% 179.1
L-glutamate catabolism gluC lo GluC aka CGL1952, component of Glutamate porter (characterized) 30% 97% 108.6 L-cystine transport system permease protein YecS 43% 179.1
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 31% 79% 105.1 L-cystine transport system permease protein YecS 43% 179.1

Sequence Analysis Tools

View WP_061531811.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLIQNVMDFLPILLRGAVVTVEVTFYSLILSTVLGLLLALMKLSQLRPVSWFAASFINII
RGLPIIVQLFYIYFVLPELGIQLSAFQAGVIGLGIAYSVYQAENFRAGIEAVDPGQIEAA
QSIGMRRAMIMRRVVLPQAFRIALPPYGNTLVMMLKDSSLVSTITVLEMTRAGQMIASST
FQNMTVYTMVALMYLLLSLPLVLLTRRLEARFGQGKRK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory